Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q5K845

Protein Details
Accession Q5K845   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
238-266DENEVNAEGKRKRKRKKKKTAVGEAIEELBasic
NLS Segment(s)
PositionSequence
195-229AEKRSRKVKGPNPLSVKKKKTPGQDKEGESKKRRR
246-256GKRKRKRKKKK
Subcellular Location(s) mito 19.5, mito_nucl 13.5, nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006984  Fcf1/Utp23  
IPR029060  PIN-like_dom_sf  
Gene Ontology GO:0005730  C:nucleolus  
GO:0032040  C:small-subunit processome  
GO:0070181  F:small ribosomal subunit rRNA binding  
GO:0000480  P:endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0000447  P:endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0000472  P:endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
Pfam View protein in Pfam  
PF04900  Fcf1  
CDD cd09865  PIN_ScUtp23p-like  
Amino Acid Sequences MRQKRAKTYKRVMTLYTQTFGFRQPFQILVSQDLLLEGAKSELNMPKQFVTVIQGECKPMITQCCMEALYKLGKPVQRTTDLAKTFERRKCNHRTALEPDECLKDVIGATNKHRYILGTQSTTLLTAMDRIPGLPVIHFNPRGVLVLSPPSTATIREKNKVEEERRLEGVKVLEGVVDGGNVVGADLAPVSGGPAEKRSRKVKGPNPLSVKKKKTPGQDKEGESKKRRRVEEEEVKEDENEVNAEGKRKRKRKKKKTAVGEAIEELNATNADRTEKAVVSDDSDGSEEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.63
3 0.55
4 0.46
5 0.39
6 0.36
7 0.37
8 0.33
9 0.26
10 0.25
11 0.25
12 0.26
13 0.26
14 0.31
15 0.27
16 0.27
17 0.27
18 0.23
19 0.2
20 0.19
21 0.17
22 0.12
23 0.1
24 0.07
25 0.06
26 0.06
27 0.06
28 0.1
29 0.14
30 0.2
31 0.22
32 0.24
33 0.24
34 0.25
35 0.25
36 0.22
37 0.21
38 0.2
39 0.2
40 0.22
41 0.22
42 0.23
43 0.23
44 0.23
45 0.2
46 0.18
47 0.2
48 0.19
49 0.19
50 0.18
51 0.2
52 0.2
53 0.2
54 0.17
55 0.17
56 0.18
57 0.18
58 0.19
59 0.21
60 0.22
61 0.25
62 0.3
63 0.33
64 0.32
65 0.34
66 0.37
67 0.41
68 0.41
69 0.4
70 0.39
71 0.4
72 0.44
73 0.47
74 0.5
75 0.46
76 0.52
77 0.59
78 0.64
79 0.66
80 0.61
81 0.62
82 0.62
83 0.67
84 0.6
85 0.52
86 0.45
87 0.39
88 0.36
89 0.3
90 0.22
91 0.14
92 0.12
93 0.14
94 0.16
95 0.16
96 0.18
97 0.26
98 0.26
99 0.26
100 0.26
101 0.23
102 0.22
103 0.26
104 0.27
105 0.21
106 0.21
107 0.21
108 0.21
109 0.2
110 0.18
111 0.11
112 0.07
113 0.07
114 0.07
115 0.07
116 0.07
117 0.06
118 0.07
119 0.08
120 0.08
121 0.06
122 0.08
123 0.09
124 0.13
125 0.14
126 0.14
127 0.13
128 0.14
129 0.14
130 0.13
131 0.11
132 0.08
133 0.11
134 0.11
135 0.11
136 0.1
137 0.11
138 0.11
139 0.12
140 0.15
141 0.2
142 0.23
143 0.28
144 0.29
145 0.31
146 0.37
147 0.43
148 0.43
149 0.43
150 0.44
151 0.43
152 0.44
153 0.42
154 0.35
155 0.3
156 0.27
157 0.19
158 0.14
159 0.11
160 0.09
161 0.08
162 0.08
163 0.05
164 0.05
165 0.04
166 0.03
167 0.03
168 0.03
169 0.03
170 0.02
171 0.02
172 0.02
173 0.02
174 0.02
175 0.02
176 0.02
177 0.02
178 0.03
179 0.04
180 0.05
181 0.1
182 0.16
183 0.2
184 0.27
185 0.33
186 0.38
187 0.45
188 0.55
189 0.58
190 0.63
191 0.66
192 0.68
193 0.71
194 0.74
195 0.75
196 0.74
197 0.74
198 0.7
199 0.72
200 0.7
201 0.72
202 0.75
203 0.74
204 0.74
205 0.75
206 0.73
207 0.73
208 0.76
209 0.75
210 0.72
211 0.73
212 0.73
213 0.72
214 0.72
215 0.7
216 0.69
217 0.7
218 0.73
219 0.71
220 0.69
221 0.64
222 0.6
223 0.53
224 0.46
225 0.36
226 0.26
227 0.18
228 0.13
229 0.14
230 0.14
231 0.21
232 0.25
233 0.33
234 0.43
235 0.52
236 0.62
237 0.7
238 0.8
239 0.85
240 0.91
241 0.93
242 0.94
243 0.95
244 0.96
245 0.94
246 0.88
247 0.8
248 0.71
249 0.6
250 0.49
251 0.38
252 0.27
253 0.18
254 0.13
255 0.1
256 0.09
257 0.09
258 0.12
259 0.13
260 0.16
261 0.19
262 0.19
263 0.21
264 0.24
265 0.24
266 0.25
267 0.27
268 0.24
269 0.21