Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0E9N9K0

Protein Details
Accession A0A0E9N9K0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
104-129IAYAKGKGKGDQKKRLRKLMPGNRARBasic
NLS Segment(s)
PositionSequence
107-129AKGKGKGDQKKRLRKLMPGNRAR
Subcellular Location(s) mito 24.5, cyto_mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR021137  Ribosomal_L35  
IPR001706  Ribosomal_L35_non-mt  
IPR037229  Ribosomal_L35_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01632  Ribosomal_L35p  
Amino Acid Sequences MKDVFLTRLFVLYANWSAKNTTQNLSVSMFGLSLARTAFTALRTGFATLPESSVFARGYKMKTHKGANKRWTALPNGGFKRKHAGHSHLNIGLSTSHLSRLTRIAYAKGKGKGDQKKRLRKLMPGNRAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.2
4 0.22
5 0.25
6 0.3
7 0.29
8 0.26
9 0.27
10 0.27
11 0.28
12 0.28
13 0.26
14 0.2
15 0.18
16 0.15
17 0.11
18 0.1
19 0.08
20 0.07
21 0.06
22 0.06
23 0.06
24 0.07
25 0.08
26 0.08
27 0.11
28 0.1
29 0.12
30 0.12
31 0.13
32 0.12
33 0.12
34 0.14
35 0.11
36 0.12
37 0.11
38 0.11
39 0.1
40 0.11
41 0.11
42 0.09
43 0.1
44 0.12
45 0.14
46 0.19
47 0.23
48 0.27
49 0.3
50 0.36
51 0.42
52 0.48
53 0.55
54 0.57
55 0.58
56 0.56
57 0.55
58 0.51
59 0.47
60 0.44
61 0.39
62 0.4
63 0.38
64 0.42
65 0.39
66 0.38
67 0.43
68 0.4
69 0.42
70 0.39
71 0.41
72 0.43
73 0.46
74 0.5
75 0.43
76 0.41
77 0.35
78 0.3
79 0.24
80 0.17
81 0.14
82 0.1
83 0.11
84 0.12
85 0.13
86 0.13
87 0.17
88 0.17
89 0.2
90 0.21
91 0.24
92 0.28
93 0.33
94 0.38
95 0.41
96 0.42
97 0.43
98 0.51
99 0.56
100 0.6
101 0.66
102 0.7
103 0.75
104 0.81
105 0.86
106 0.82
107 0.82
108 0.83
109 0.83