Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0E9NQ79

Protein Details
Accession A0A0E9NQ79    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
9-30YIPKGPASRRIRTPRGRFRRAEBasic
NLS Segment(s)
PositionSequence
15-27ASRRIRTPRGRFR
Subcellular Location(s) mito 21, cyto 5
Family & Domain DBs
Amino Acid Sequences MVFYVVVAYIPKGPASRRIRTPRGRFRRAEATAHPDLQHDIYTPGVGPSAILPRNTSTGTVRKMMNLVIEIAIAIGLHSGQYRFDTYACKSADGNKKKSAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.31
3 0.37
4 0.45
5 0.54
6 0.62
7 0.7
8 0.79
9 0.8
10 0.84
11 0.85
12 0.78
13 0.75
14 0.75
15 0.68
16 0.63
17 0.56
18 0.53
19 0.48
20 0.47
21 0.4
22 0.31
23 0.28
24 0.24
25 0.2
26 0.13
27 0.11
28 0.09
29 0.09
30 0.08
31 0.07
32 0.06
33 0.05
34 0.05
35 0.05
36 0.09
37 0.1
38 0.11
39 0.11
40 0.12
41 0.15
42 0.15
43 0.15
44 0.14
45 0.18
46 0.2
47 0.23
48 0.22
49 0.21
50 0.21
51 0.2
52 0.18
53 0.14
54 0.12
55 0.09
56 0.08
57 0.08
58 0.07
59 0.06
60 0.04
61 0.03
62 0.03
63 0.02
64 0.03
65 0.04
66 0.04
67 0.05
68 0.08
69 0.1
70 0.11
71 0.12
72 0.17
73 0.19
74 0.27
75 0.27
76 0.27
77 0.26
78 0.34
79 0.44
80 0.48
81 0.51