Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0E9N8R4

Protein Details
Accession A0A0E9N8R4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
102-127EDEKMKWRNKEEIRKRNREEIKNANFHydrophilic
NLS Segment(s)
PositionSequence
78-123KSAKKAKVRENNQIAGEAARAKREEDEKMKWRNKEEIRKRNREEIK
Subcellular Location(s) mito 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MLRSRACTLLRRPLCHVRHSSTGQTWTAPTSILPAGSPMKGLNFVAGAQDPVALPESEYPAWLWSIATPSTDPKSLAKSAKKAKVRENNQIAGEAARAKREEDEKMKWRNKEEIRKRNREEIKNANFLSKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.62
3 0.62
4 0.57
5 0.58
6 0.58
7 0.57
8 0.51
9 0.52
10 0.45
11 0.39
12 0.34
13 0.28
14 0.24
15 0.19
16 0.14
17 0.13
18 0.12
19 0.11
20 0.1
21 0.11
22 0.13
23 0.13
24 0.13
25 0.1
26 0.11
27 0.12
28 0.12
29 0.09
30 0.08
31 0.08
32 0.09
33 0.09
34 0.08
35 0.06
36 0.07
37 0.06
38 0.06
39 0.07
40 0.06
41 0.06
42 0.07
43 0.1
44 0.09
45 0.1
46 0.09
47 0.08
48 0.09
49 0.08
50 0.08
51 0.05
52 0.07
53 0.07
54 0.07
55 0.07
56 0.1
57 0.11
58 0.12
59 0.13
60 0.12
61 0.16
62 0.2
63 0.25
64 0.27
65 0.33
66 0.41
67 0.48
68 0.54
69 0.54
70 0.6
71 0.64
72 0.66
73 0.69
74 0.67
75 0.63
76 0.57
77 0.54
78 0.44
79 0.34
80 0.29
81 0.23
82 0.18
83 0.16
84 0.16
85 0.16
86 0.19
87 0.22
88 0.28
89 0.3
90 0.38
91 0.43
92 0.53
93 0.59
94 0.61
95 0.62
96 0.65
97 0.68
98 0.71
99 0.74
100 0.74
101 0.78
102 0.84
103 0.85
104 0.86
105 0.86
106 0.83
107 0.81
108 0.81
109 0.78
110 0.77
111 0.72