Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0E9NC46

Protein Details
Accession A0A0E9NC46    Localization Confidence Low Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
64-83QKVPCKCPARRWLLHQRDPCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, plas 6, cyto 4, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR019182  Cytochrome_b-c1_su10_fun  
Gene Ontology GO:0005750  C:mitochondrial respiratory chain complex III  
GO:0006122  P:mitochondrial electron transport, ubiquinol to cytochrome c  
Pfam View protein in Pfam  
PF09796  QCR10  
Amino Acid Sequences MYSSVSPIPSGYGPRYGAQPHFLKMTPEKFGRWAPSLVAWGATAGVAAIFLLSGLPRMKRDVLQKVPCKCPARRWLLHQRDPCF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.26
3 0.27
4 0.27
5 0.3
6 0.3
7 0.27
8 0.28
9 0.28
10 0.28
11 0.3
12 0.32
13 0.31
14 0.3
15 0.29
16 0.3
17 0.32
18 0.32
19 0.29
20 0.26
21 0.21
22 0.21
23 0.21
24 0.18
25 0.15
26 0.1
27 0.08
28 0.07
29 0.06
30 0.05
31 0.03
32 0.03
33 0.02
34 0.02
35 0.02
36 0.02
37 0.02
38 0.02
39 0.02
40 0.04
41 0.06
42 0.07
43 0.08
44 0.11
45 0.13
46 0.18
47 0.25
48 0.33
49 0.41
50 0.5
51 0.57
52 0.61
53 0.66
54 0.7
55 0.69
56 0.63
57 0.63
58 0.64
59 0.66
60 0.65
61 0.68
62 0.71
63 0.75
64 0.81