Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0E9NRH1

Protein Details
Accession A0A0E9NRH1   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
25-44QALKRKPYYKSQKQTPKDISHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 13, cyto 6, cyto_nucl 4.833, mito 4.5, mito_nucl 3.666
Family & Domain DBs
Amino Acid Sequences MGNNQKSILVILYKTSPSPLPSQLQALKRKPYYKSQKQTPKDISVYHSCVCVCIKCNKQASPQLQAERRCLGVGLLEVLLGVLDVGLDGVATLLPVGGADL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.18
4 0.18
5 0.22
6 0.24
7 0.24
8 0.25
9 0.31
10 0.35
11 0.4
12 0.47
13 0.48
14 0.52
15 0.54
16 0.58
17 0.55
18 0.6
19 0.63
20 0.65
21 0.69
22 0.71
23 0.76
24 0.75
25 0.81
26 0.76
27 0.71
28 0.63
29 0.55
30 0.49
31 0.44
32 0.43
33 0.34
34 0.3
35 0.23
36 0.22
37 0.21
38 0.17
39 0.15
40 0.18
41 0.21
42 0.27
43 0.32
44 0.33
45 0.38
46 0.45
47 0.46
48 0.46
49 0.48
50 0.48
51 0.49
52 0.5
53 0.47
54 0.41
55 0.38
56 0.31
57 0.26
58 0.19
59 0.14
60 0.12
61 0.09
62 0.08
63 0.07
64 0.06
65 0.06
66 0.06
67 0.04
68 0.03
69 0.02
70 0.02
71 0.02
72 0.02
73 0.02
74 0.02
75 0.02
76 0.02
77 0.02
78 0.02
79 0.03
80 0.02
81 0.03