Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0E9ND15

Protein Details
Accession A0A0E9ND15    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
61-82DDVKPRGKTRNIVRREKRDVGLBasic
NLS Segment(s)
Subcellular Location(s) nucl 10, cyto 8, mito 4, plas 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MDQSLPTIDRRRPRQLGGPRQYTHAGCYIYIYMYLIAGGVVTSHALIAAGALFACAQNPRDDVKPRGKTRNIVRREKRDVGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.68
3 0.73
4 0.72
5 0.73
6 0.64
7 0.64
8 0.63
9 0.54
10 0.45
11 0.39
12 0.3
13 0.21
14 0.22
15 0.18
16 0.14
17 0.14
18 0.12
19 0.07
20 0.06
21 0.06
22 0.04
23 0.03
24 0.03
25 0.03
26 0.02
27 0.02
28 0.02
29 0.02
30 0.02
31 0.02
32 0.02
33 0.02
34 0.02
35 0.02
36 0.02
37 0.02
38 0.02
39 0.03
40 0.03
41 0.04
42 0.05
43 0.06
44 0.08
45 0.1
46 0.13
47 0.18
48 0.24
49 0.3
50 0.39
51 0.48
52 0.54
53 0.62
54 0.65
55 0.68
56 0.73
57 0.77
58 0.75
59 0.77
60 0.8
61 0.8
62 0.84