Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

P0CO56

Protein Details
Accession P0CO56    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
33-65HRPAPRPALGRCRPPHRRRRRLRPPVRPPVSLPBasic
NLS Segment(s)
PositionSequence
33-59HRPAPRPALGRCRPPHRRRRRLRPPVR
Subcellular Location(s) mito 12, nucl 8, cyto 3, plas 2, cyto_pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR016651  PPM1  
IPR007213  Ppm1/Ppm2/Tcmp  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0018423  F:protein C-terminal leucine carboxyl O-methyltransferase activity  
GO:0006481  P:C-terminal protein methylation  
Pfam View protein in Pfam  
PF04072  LCM  
Amino Acid Sequences MTQCGDRRLLALIIYHGAIQTPPPTDPNAAPAHRPAPRPALGRCRPPHRRRRRLRPPVRPPVSLPVALTTRSSAAQLGYLQDPFASLLYRPPMPQPGAFAPQAVGRARKPPLINVGTHHRTWGIDRLVDRFLQRGGKQVVSLGAGSDTRFWRLMSRATPPDLARYVEIDFPHLTSPKAQRIARHRKLYQYLGPSSTAMPPPGHPYTVSKGGTQLSSPLYTLLPLDLRPSPSEPASSISAILSHHVLPQLDPRLPTLFLAECLFPYMSPEDSREIIKWFGETFCSCMGVVYEMVGLDDSFGNVMKRNLAVRNLSIPGSIFSTPESQAGRFTSPMLQGGKFDSAGAKTLWQIREEDVGPEELQRISKLEILDEIEELRLVLEHYVIAWGTKGECMSSISL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.13
4 0.13
5 0.12
6 0.12
7 0.13
8 0.14
9 0.15
10 0.17
11 0.2
12 0.23
13 0.24
14 0.28
15 0.32
16 0.32
17 0.33
18 0.36
19 0.4
20 0.43
21 0.45
22 0.44
23 0.44
24 0.48
25 0.5
26 0.52
27 0.56
28 0.57
29 0.64
30 0.67
31 0.7
32 0.75
33 0.8
34 0.85
35 0.85
36 0.9
37 0.91
38 0.94
39 0.95
40 0.95
41 0.96
42 0.96
43 0.96
44 0.96
45 0.91
46 0.83
47 0.75
48 0.73
49 0.66
50 0.56
51 0.46
52 0.39
53 0.35
54 0.32
55 0.29
56 0.21
57 0.18
58 0.17
59 0.17
60 0.13
61 0.11
62 0.12
63 0.13
64 0.14
65 0.14
66 0.14
67 0.13
68 0.12
69 0.12
70 0.11
71 0.1
72 0.08
73 0.07
74 0.11
75 0.14
76 0.16
77 0.16
78 0.18
79 0.24
80 0.25
81 0.26
82 0.27
83 0.28
84 0.31
85 0.3
86 0.27
87 0.22
88 0.21
89 0.25
90 0.22
91 0.21
92 0.18
93 0.24
94 0.26
95 0.31
96 0.3
97 0.3
98 0.37
99 0.37
100 0.36
101 0.34
102 0.41
103 0.39
104 0.38
105 0.35
106 0.27
107 0.25
108 0.26
109 0.29
110 0.22
111 0.21
112 0.22
113 0.25
114 0.25
115 0.26
116 0.25
117 0.18
118 0.19
119 0.22
120 0.21
121 0.25
122 0.27
123 0.26
124 0.25
125 0.25
126 0.23
127 0.19
128 0.18
129 0.11
130 0.09
131 0.08
132 0.09
133 0.11
134 0.11
135 0.11
136 0.12
137 0.12
138 0.14
139 0.16
140 0.2
141 0.19
142 0.25
143 0.26
144 0.28
145 0.31
146 0.29
147 0.3
148 0.27
149 0.26
150 0.2
151 0.18
152 0.18
153 0.17
154 0.17
155 0.15
156 0.14
157 0.13
158 0.15
159 0.14
160 0.13
161 0.15
162 0.19
163 0.22
164 0.29
165 0.29
166 0.33
167 0.44
168 0.55
169 0.58
170 0.62
171 0.58
172 0.58
173 0.62
174 0.6
175 0.54
176 0.49
177 0.42
178 0.36
179 0.34
180 0.29
181 0.25
182 0.23
183 0.19
184 0.14
185 0.13
186 0.12
187 0.17
188 0.17
189 0.16
190 0.14
191 0.17
192 0.19
193 0.25
194 0.26
195 0.2
196 0.21
197 0.22
198 0.22
199 0.19
200 0.17
201 0.12
202 0.11
203 0.11
204 0.1
205 0.09
206 0.09
207 0.09
208 0.08
209 0.07
210 0.06
211 0.09
212 0.09
213 0.11
214 0.12
215 0.14
216 0.15
217 0.15
218 0.16
219 0.14
220 0.15
221 0.16
222 0.15
223 0.13
224 0.11
225 0.12
226 0.11
227 0.11
228 0.09
229 0.08
230 0.09
231 0.1
232 0.1
233 0.1
234 0.15
235 0.18
236 0.18
237 0.18
238 0.19
239 0.2
240 0.2
241 0.19
242 0.17
243 0.13
244 0.13
245 0.14
246 0.12
247 0.1
248 0.12
249 0.11
250 0.09
251 0.1
252 0.11
253 0.11
254 0.12
255 0.14
256 0.14
257 0.16
258 0.17
259 0.16
260 0.17
261 0.17
262 0.16
263 0.15
264 0.13
265 0.13
266 0.15
267 0.14
268 0.14
269 0.14
270 0.15
271 0.13
272 0.12
273 0.12
274 0.11
275 0.1
276 0.08
277 0.08
278 0.06
279 0.06
280 0.06
281 0.06
282 0.05
283 0.05
284 0.05
285 0.05
286 0.06
287 0.06
288 0.08
289 0.09
290 0.1
291 0.12
292 0.15
293 0.18
294 0.22
295 0.24
296 0.24
297 0.28
298 0.28
299 0.27
300 0.24
301 0.21
302 0.18
303 0.18
304 0.16
305 0.12
306 0.12
307 0.15
308 0.15
309 0.19
310 0.19
311 0.17
312 0.19
313 0.22
314 0.22
315 0.2
316 0.21
317 0.21
318 0.21
319 0.25
320 0.25
321 0.23
322 0.22
323 0.25
324 0.25
325 0.21
326 0.2
327 0.18
328 0.15
329 0.17
330 0.16
331 0.15
332 0.16
333 0.23
334 0.24
335 0.23
336 0.24
337 0.24
338 0.29
339 0.28
340 0.27
341 0.22
342 0.22
343 0.21
344 0.21
345 0.2
346 0.17
347 0.17
348 0.16
349 0.16
350 0.16
351 0.19
352 0.18
353 0.17
354 0.18
355 0.2
356 0.2
357 0.19
358 0.18
359 0.15
360 0.14
361 0.13
362 0.1
363 0.08
364 0.07
365 0.07
366 0.07
367 0.06
368 0.07
369 0.08
370 0.08
371 0.08
372 0.08
373 0.09
374 0.09
375 0.11
376 0.11
377 0.1
378 0.11