Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0E9N7G7

Protein Details
Accession A0A0E9N7G7    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
46-79GFWVSCCLYRRRRPRSRRRRRCGRYDLRLLHRCIHydrophilic
NLS Segment(s)
PositionSequence
55-66RRRRPRSRRRRR
Subcellular Location(s) mito 11, nucl 6.5, cyto_nucl 6, cyto 4.5, extr 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MVSFARSNSCPANIQLLALLASTYVASPIDSIVQCSSLSLLLLSLGFWVSCCLYRRRRPRSRRRRRCGRYDLRLLHRCILHHDIYHRLH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.21
3 0.19
4 0.16
5 0.14
6 0.12
7 0.05
8 0.05
9 0.05
10 0.04
11 0.04
12 0.04
13 0.04
14 0.04
15 0.05
16 0.08
17 0.08
18 0.09
19 0.09
20 0.1
21 0.1
22 0.1
23 0.1
24 0.07
25 0.07
26 0.05
27 0.05
28 0.04
29 0.04
30 0.04
31 0.03
32 0.03
33 0.03
34 0.03
35 0.04
36 0.04
37 0.07
38 0.1
39 0.16
40 0.24
41 0.34
42 0.44
43 0.55
44 0.65
45 0.73
46 0.82
47 0.88
48 0.91
49 0.94
50 0.94
51 0.95
52 0.93
53 0.93
54 0.93
55 0.92
56 0.9
57 0.89
58 0.87
59 0.85
60 0.84
61 0.76
62 0.7
63 0.62
64 0.53
65 0.5
66 0.47
67 0.4
68 0.37
69 0.37