Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0E9NQM7

Protein Details
Accession A0A0E9NQM7    Localization Confidence Low Confidence Score 6.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MWVHARCPPHAKHRPKQPTIATCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, nucl 4, cyto 4, cyto_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR016635  AP_complex_ssu  
IPR022775  AP_mu_sigma_su  
IPR027156  APS2  
IPR011012  Longin-like_dom_sf  
Gene Ontology GO:0030122  C:AP-2 adaptor complex  
GO:0035615  F:clathrin adaptor activity  
GO:0072583  P:clathrin-dependent endocytosis  
GO:0006886  P:intracellular protein transport  
Pfam View protein in Pfam  
PF01217  Clat_adaptor_s  
CDD cd14833  AP2_sigma  
Amino Acid Sequences MWVHARCPPHAKHRPKQPTIATCSTMIRFILIQNRQGKTRLAKWYVPYDDAEKVKLKGDVHRLIAPRDQKHQSNFVEFRNHKIVYRRYAGLFFCICVDTNDNELAYLEAIHLFVEVLDSFFGNVCELDLVFNFYKVYAILDEVFLAGEIEETSKNVVLARLEHLGQLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.8
3 0.83
4 0.81
5 0.8
6 0.78
7 0.74
8 0.65
9 0.56
10 0.54
11 0.46
12 0.38
13 0.29
14 0.22
15 0.17
16 0.18
17 0.24
18 0.24
19 0.3
20 0.35
21 0.37
22 0.38
23 0.4
24 0.41
25 0.38
26 0.43
27 0.45
28 0.43
29 0.45
30 0.47
31 0.53
32 0.51
33 0.47
34 0.41
35 0.35
36 0.35
37 0.32
38 0.31
39 0.25
40 0.23
41 0.23
42 0.25
43 0.23
44 0.23
45 0.31
46 0.32
47 0.33
48 0.36
49 0.36
50 0.35
51 0.38
52 0.39
53 0.34
54 0.36
55 0.37
56 0.36
57 0.38
58 0.43
59 0.4
60 0.41
61 0.4
62 0.37
63 0.42
64 0.38
65 0.4
66 0.39
67 0.37
68 0.32
69 0.37
70 0.39
71 0.34
72 0.37
73 0.33
74 0.29
75 0.31
76 0.29
77 0.26
78 0.21
79 0.16
80 0.14
81 0.13
82 0.12
83 0.1
84 0.13
85 0.1
86 0.12
87 0.12
88 0.11
89 0.11
90 0.11
91 0.1
92 0.07
93 0.06
94 0.05
95 0.04
96 0.04
97 0.04
98 0.04
99 0.04
100 0.03
101 0.04
102 0.04
103 0.04
104 0.05
105 0.05
106 0.05
107 0.05
108 0.06
109 0.05
110 0.05
111 0.05
112 0.05
113 0.05
114 0.06
115 0.06
116 0.1
117 0.1
118 0.11
119 0.11
120 0.1
121 0.11
122 0.1
123 0.12
124 0.07
125 0.09
126 0.09
127 0.09
128 0.09
129 0.09
130 0.09
131 0.07
132 0.07
133 0.05
134 0.05
135 0.04
136 0.06
137 0.06
138 0.07
139 0.09
140 0.09
141 0.1
142 0.1
143 0.12
144 0.12
145 0.14
146 0.17
147 0.19
148 0.19