Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0E9NCJ0

Protein Details
Accession A0A0E9NCJ0    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
109-130TPFLNRRKTAKKSKKLKVEDEYHydrophilic
NLS Segment(s)
PositionSequence
114-123RRKTAKKSKK
Subcellular Location(s) nucl 14, mito_nucl 13.333, mito 11.5, cyto_nucl 8.333
Family & Domain DBs
Amino Acid Sequences MPNTSSKLLFLRRKSATASRYSSSDERYEETIRLIPVPRNLPDPDSPEVFTTLLDKNIAGESIFTIFTRKRSSKRQERMTTVITERDITDCVDAGLLEEKSEIMAGNNTPFLNRRKTAKKSKKLKVEDEYFTAEPAPTRCNTFAVTGVRPTMLNAPDLRETKEEQVDHGSKDRPKLPRRDAAMDVKDFEEFSGVAEWYQKELRDLM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.57
3 0.53
4 0.53
5 0.53
6 0.46
7 0.45
8 0.49
9 0.46
10 0.42
11 0.41
12 0.35
13 0.32
14 0.34
15 0.34
16 0.29
17 0.28
18 0.27
19 0.24
20 0.24
21 0.24
22 0.23
23 0.27
24 0.31
25 0.3
26 0.31
27 0.32
28 0.33
29 0.34
30 0.35
31 0.33
32 0.3
33 0.3
34 0.26
35 0.27
36 0.23
37 0.19
38 0.17
39 0.15
40 0.14
41 0.13
42 0.12
43 0.11
44 0.11
45 0.11
46 0.08
47 0.07
48 0.07
49 0.08
50 0.08
51 0.07
52 0.1
53 0.1
54 0.14
55 0.21
56 0.25
57 0.29
58 0.39
59 0.5
60 0.58
61 0.67
62 0.74
63 0.74
64 0.76
65 0.75
66 0.68
67 0.61
68 0.52
69 0.44
70 0.34
71 0.27
72 0.22
73 0.17
74 0.15
75 0.12
76 0.1
77 0.08
78 0.07
79 0.06
80 0.06
81 0.05
82 0.07
83 0.06
84 0.06
85 0.06
86 0.06
87 0.05
88 0.06
89 0.05
90 0.03
91 0.04
92 0.05
93 0.05
94 0.07
95 0.07
96 0.07
97 0.1
98 0.13
99 0.18
100 0.2
101 0.26
102 0.33
103 0.41
104 0.53
105 0.6
106 0.68
107 0.73
108 0.79
109 0.83
110 0.81
111 0.81
112 0.78
113 0.73
114 0.65
115 0.58
116 0.55
117 0.44
118 0.38
119 0.3
120 0.22
121 0.17
122 0.16
123 0.15
124 0.11
125 0.14
126 0.15
127 0.16
128 0.17
129 0.17
130 0.21
131 0.22
132 0.23
133 0.21
134 0.21
135 0.2
136 0.18
137 0.18
138 0.19
139 0.15
140 0.16
141 0.16
142 0.18
143 0.24
144 0.25
145 0.27
146 0.24
147 0.26
148 0.29
149 0.34
150 0.31
151 0.27
152 0.34
153 0.33
154 0.33
155 0.35
156 0.36
157 0.34
158 0.39
159 0.44
160 0.45
161 0.51
162 0.59
163 0.62
164 0.65
165 0.69
166 0.69
167 0.69
168 0.69
169 0.67
170 0.59
171 0.54
172 0.46
173 0.4
174 0.33
175 0.27
176 0.19
177 0.12
178 0.11
179 0.12
180 0.11
181 0.11
182 0.15
183 0.15
184 0.17
185 0.2
186 0.2