Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0E9NDN1

Protein Details
Accession A0A0E9NDN1    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MKAKEVQKKRRERKAAAFIVEHydrophilic
NLS Segment(s)
PositionSequence
8-14KKRRERK
Subcellular Location(s) mito 10, extr 9, nucl 3, cyto 2, pero 2, cyto_pero 2
Family & Domain DBs
Amino Acid Sequences MKAKEVQKKRRERKAAAFIVEKYASIPIIPLLLLVQFSRKFGGRSQIQSATNGKAIDLDPAVRHPSHRSSIQTTTC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.83
3 0.78
4 0.71
5 0.61
6 0.57
7 0.49
8 0.38
9 0.28
10 0.22
11 0.16
12 0.12
13 0.11
14 0.06
15 0.06
16 0.05
17 0.05
18 0.04
19 0.04
20 0.05
21 0.05
22 0.08
23 0.08
24 0.09
25 0.1
26 0.11
27 0.12
28 0.13
29 0.21
30 0.21
31 0.25
32 0.29
33 0.33
34 0.33
35 0.36
36 0.37
37 0.31
38 0.3
39 0.26
40 0.21
41 0.17
42 0.16
43 0.16
44 0.14
45 0.13
46 0.11
47 0.14
48 0.18
49 0.17
50 0.19
51 0.21
52 0.27
53 0.31
54 0.35
55 0.38
56 0.41