Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0E9NH23

Protein Details
Accession A0A0E9NH23    Localization Confidence High Confidence Score 23.5
NoLS Segment(s)
PositionSequenceProtein Nature
22-51SDRYSSHRSHRERSRSPYRRDRDRGRDYDGBasic
88-114DDYRRDRSRDRSRSQPRRRSPPPHTRRBasic
176-196GVEIKQKREYRQYMNRKGGFNHydrophilic
NLS Segment(s)
PositionSequence
34-47RSRSPYRRDRDRGR
85-86RR
89-131DYRRDRSRDRSRSQPRRRSPPPHTRRSPAHHHQSSRPRSPSPK
Subcellular Location(s) nucl 26.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR013957  SNRNP27  
Gene Ontology GO:0005634  C:nucleus  
GO:0006397  P:mRNA processing  
GO:0008380  P:RNA splicing  
Pfam View protein in Pfam  
PF08648  SNRNP27  
Amino Acid Sequences MPRSPPLQYDYDAPLNSDKNSSDRYSSHRSHRERSRSPYRRDRDRGRDYDGKGRDGGDRDYRRSDRGDRRYRDYDAERAGDGNRRRDDDYRRDRSRDRSRSQPRRRSPPPHTRRSPAHHHQSSRPRSPSPKAAPSAPAPIDLNDLANDDMEAQMQAMMGFGGFETTKLKKHGDIGGVEIKQKREYRQYMNRKGGFNRPLDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.32
3 0.31
4 0.29
5 0.25
6 0.23
7 0.27
8 0.28
9 0.27
10 0.28
11 0.34
12 0.4
13 0.44
14 0.5
15 0.56
16 0.59
17 0.65
18 0.72
19 0.76
20 0.75
21 0.79
22 0.8
23 0.8
24 0.83
25 0.85
26 0.83
27 0.84
28 0.85
29 0.86
30 0.85
31 0.85
32 0.81
33 0.78
34 0.77
35 0.7
36 0.7
37 0.63
38 0.54
39 0.45
40 0.41
41 0.37
42 0.31
43 0.32
44 0.32
45 0.34
46 0.35
47 0.42
48 0.42
49 0.41
50 0.43
51 0.48
52 0.48
53 0.55
54 0.61
55 0.58
56 0.64
57 0.66
58 0.64
59 0.61
60 0.55
61 0.49
62 0.43
63 0.39
64 0.32
65 0.28
66 0.27
67 0.27
68 0.27
69 0.29
70 0.28
71 0.29
72 0.31
73 0.35
74 0.41
75 0.45
76 0.52
77 0.54
78 0.56
79 0.58
80 0.59
81 0.65
82 0.68
83 0.67
84 0.61
85 0.62
86 0.69
87 0.76
88 0.83
89 0.83
90 0.8
91 0.8
92 0.84
93 0.83
94 0.81
95 0.81
96 0.79
97 0.79
98 0.77
99 0.73
100 0.71
101 0.69
102 0.69
103 0.66
104 0.68
105 0.63
106 0.62
107 0.64
108 0.68
109 0.69
110 0.68
111 0.63
112 0.57
113 0.57
114 0.58
115 0.59
116 0.56
117 0.56
118 0.5
119 0.48
120 0.47
121 0.43
122 0.45
123 0.35
124 0.3
125 0.24
126 0.22
127 0.23
128 0.2
129 0.18
130 0.12
131 0.13
132 0.11
133 0.1
134 0.09
135 0.07
136 0.07
137 0.06
138 0.06
139 0.05
140 0.05
141 0.05
142 0.05
143 0.04
144 0.04
145 0.03
146 0.03
147 0.03
148 0.04
149 0.04
150 0.05
151 0.09
152 0.11
153 0.15
154 0.18
155 0.2
156 0.21
157 0.26
158 0.31
159 0.32
160 0.32
161 0.33
162 0.38
163 0.37
164 0.4
165 0.38
166 0.36
167 0.38
168 0.41
169 0.42
170 0.44
171 0.51
172 0.56
173 0.63
174 0.72
175 0.76
176 0.82
177 0.82
178 0.77
179 0.75
180 0.75
181 0.71