Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0E9NM82

Protein Details
Accession A0A0E9NM82    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
25-53KQSPYTPSQRKSRKRTRSHRYYHPPPFSYHydrophilic
NLS Segment(s)
PositionSequence
34-40RKSRKRT
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MNKRTTGSKQSILPLNGTTHKNKGKQSPYTPSQRKSRKRTRSHRYYHPPPFSYPIILLLLLLQTTHKVMNAVVRC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.36
3 0.36
4 0.36
5 0.33
6 0.34
7 0.4
8 0.43
9 0.46
10 0.51
11 0.53
12 0.58
13 0.61
14 0.61
15 0.61
16 0.66
17 0.68
18 0.64
19 0.66
20 0.68
21 0.71
22 0.73
23 0.78
24 0.78
25 0.82
26 0.87
27 0.88
28 0.88
29 0.86
30 0.87
31 0.86
32 0.86
33 0.85
34 0.82
35 0.74
36 0.66
37 0.63
38 0.54
39 0.46
40 0.36
41 0.28
42 0.22
43 0.19
44 0.16
45 0.11
46 0.1
47 0.08
48 0.08
49 0.06
50 0.06
51 0.07
52 0.08
53 0.08
54 0.09
55 0.1