Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0E9NL87

Protein Details
Accession A0A0E9NL87    Localization Confidence High Confidence Score 17.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-34MANPQQRQKQKSGKAKLTRKTAQQRKKVPIKGSEHydrophilic
175-197SAGQIKRKIKVWRENGKKQKMVAHydrophilic
NLS Segment(s)
PositionSequence
9-29KQKSGKAKLTRKTAQQRKKVP
181-191RKIKVWRENGK
Subcellular Location(s) nucl 20.5, mito_nucl 12, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR019002  Ribosome_biogenesis_Nop16  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF09420  Nop16  
Amino Acid Sequences MANPQQRQKQKSGKAKLTRKTAQQRKKVPIKGSEIIAANWDKKFTLKQNYARLGLVATPNPLSGGSEKLNPPKKLDVEKEKSKLKANEAIIERDEAGNVVNIIYGKAPLEDMDIEPVEAKTEVVKQLEEQASKAVKATRVVSENEEKWLQALVDKHGDDYEAMFRDRKLNTMQNSAGQIKRKIKVWRENGKKQKMVAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.87
3 0.86
4 0.85
5 0.82
6 0.81
7 0.82
8 0.83
9 0.82
10 0.83
11 0.84
12 0.84
13 0.88
14 0.85
15 0.81
16 0.78
17 0.76
18 0.7
19 0.62
20 0.56
21 0.48
22 0.4
23 0.37
24 0.32
25 0.26
26 0.23
27 0.22
28 0.17
29 0.18
30 0.23
31 0.26
32 0.34
33 0.4
34 0.47
35 0.56
36 0.6
37 0.6
38 0.55
39 0.48
40 0.38
41 0.32
42 0.27
43 0.18
44 0.15
45 0.13
46 0.13
47 0.13
48 0.12
49 0.11
50 0.09
51 0.12
52 0.12
53 0.15
54 0.18
55 0.26
56 0.34
57 0.34
58 0.37
59 0.38
60 0.41
61 0.44
62 0.49
63 0.5
64 0.5
65 0.57
66 0.59
67 0.59
68 0.57
69 0.57
70 0.53
71 0.47
72 0.46
73 0.4
74 0.4
75 0.37
76 0.37
77 0.3
78 0.28
79 0.24
80 0.17
81 0.15
82 0.09
83 0.07
84 0.05
85 0.05
86 0.04
87 0.04
88 0.04
89 0.04
90 0.04
91 0.04
92 0.04
93 0.04
94 0.04
95 0.04
96 0.05
97 0.06
98 0.06
99 0.08
100 0.08
101 0.08
102 0.08
103 0.08
104 0.07
105 0.07
106 0.07
107 0.06
108 0.08
109 0.1
110 0.11
111 0.11
112 0.1
113 0.17
114 0.21
115 0.2
116 0.19
117 0.21
118 0.21
119 0.21
120 0.22
121 0.18
122 0.16
123 0.19
124 0.21
125 0.2
126 0.22
127 0.24
128 0.27
129 0.31
130 0.29
131 0.31
132 0.29
133 0.24
134 0.22
135 0.21
136 0.17
137 0.14
138 0.15
139 0.14
140 0.19
141 0.2
142 0.2
143 0.19
144 0.2
145 0.17
146 0.17
147 0.18
148 0.15
149 0.16
150 0.17
151 0.18
152 0.23
153 0.23
154 0.25
155 0.27
156 0.32
157 0.35
158 0.41
159 0.42
160 0.4
161 0.45
162 0.47
163 0.45
164 0.43
165 0.47
166 0.48
167 0.5
168 0.53
169 0.57
170 0.62
171 0.67
172 0.72
173 0.75
174 0.77
175 0.85
176 0.88
177 0.89
178 0.84