Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0B2UIW0

Protein Details
Accession A0A0B2UIW0    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
24-43FVEKHKKRTAVKPRVSRSDLHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 18, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR000915  60S_ribosomal_L6E  
IPR014722  Rib_L2_dom2  
IPR008991  Translation_prot_SH3-like_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01159  Ribosomal_L6e  
Amino Acid Sequences MLIKDVRVIADEAGLYMPDDIPAFVEKHKKRTAVKPRVSRSDLTSGMIVVVLEGVYAAKRVVYLKSLENNLTLCVGPRSINGVGLFKIDERYLLATSTVLKIDVDAKIDCENVFLAERDVYALPNAGASSTEQKIDEQVMKAVKAVEYMKTYLSEQFEIDATKDFYSLKY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.08
3 0.08
4 0.08
5 0.07
6 0.07
7 0.07
8 0.08
9 0.1
10 0.11
11 0.14
12 0.24
13 0.27
14 0.35
15 0.4
16 0.45
17 0.5
18 0.59
19 0.67
20 0.68
21 0.74
22 0.76
23 0.79
24 0.81
25 0.78
26 0.7
27 0.63
28 0.6
29 0.51
30 0.43
31 0.35
32 0.26
33 0.22
34 0.2
35 0.14
36 0.07
37 0.05
38 0.03
39 0.03
40 0.03
41 0.03
42 0.03
43 0.03
44 0.03
45 0.03
46 0.04
47 0.06
48 0.07
49 0.08
50 0.11
51 0.14
52 0.17
53 0.2
54 0.19
55 0.19
56 0.19
57 0.17
58 0.16
59 0.13
60 0.1
61 0.08
62 0.08
63 0.08
64 0.07
65 0.11
66 0.1
67 0.12
68 0.12
69 0.13
70 0.12
71 0.12
72 0.12
73 0.08
74 0.09
75 0.07
76 0.06
77 0.06
78 0.08
79 0.08
80 0.08
81 0.08
82 0.07
83 0.08
84 0.09
85 0.08
86 0.07
87 0.06
88 0.06
89 0.08
90 0.09
91 0.1
92 0.09
93 0.11
94 0.11
95 0.12
96 0.11
97 0.1
98 0.09
99 0.08
100 0.09
101 0.08
102 0.08
103 0.08
104 0.08
105 0.09
106 0.09
107 0.08
108 0.08
109 0.08
110 0.07
111 0.07
112 0.07
113 0.06
114 0.06
115 0.07
116 0.12
117 0.12
118 0.14
119 0.14
120 0.14
121 0.16
122 0.18
123 0.2
124 0.16
125 0.2
126 0.21
127 0.2
128 0.21
129 0.21
130 0.17
131 0.18
132 0.18
133 0.18
134 0.19
135 0.2
136 0.2
137 0.21
138 0.22
139 0.23
140 0.25
141 0.23
142 0.2
143 0.2
144 0.2
145 0.19
146 0.19
147 0.18
148 0.17
149 0.16
150 0.16