Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B2UCS6

Protein Details
Accession A0A0B2UCS6   
Localization Confidence High
Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
8-30STEKRKFRSLLAKKKRLKKEIFAHydrophilic
NLS Segment(s)
PositionSequence
11-26KRKFRSLLAKKKRLKK
Subcellular Location(s) nucl 18, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR015418  Eaf6  
Gene Ontology GO:0000123  C:histone acetyltransferase complex  
GO:0005634  C:nucleus  
GO:0016740  F:transferase activity  
GO:0006325  P:chromatin organization  
GO:0016573  P:histone acetylation  
Pfam View protein in Pfam  
PF09340  NuA4  
Amino Acid Sequences MANGINTSTEKRKFRSLLAKKKRLKKEIFAIEKELFKTETAHLEMTQGAPITKNVDYYTSNRIDKKKSAVNDKMRMFNRNFPMPNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.59
3 0.62
4 0.66
5 0.72
6 0.78
7 0.78
8 0.86
9 0.88
10 0.86
11 0.81
12 0.78
13 0.77
14 0.77
15 0.75
16 0.68
17 0.63
18 0.56
19 0.52
20 0.45
21 0.36
22 0.26
23 0.19
24 0.19
25 0.15
26 0.15
27 0.15
28 0.15
29 0.13
30 0.13
31 0.13
32 0.11
33 0.11
34 0.08
35 0.06
36 0.06
37 0.07
38 0.09
39 0.09
40 0.1
41 0.1
42 0.12
43 0.15
44 0.17
45 0.23
46 0.26
47 0.29
48 0.33
49 0.38
50 0.4
51 0.42
52 0.46
53 0.46
54 0.48
55 0.54
56 0.59
57 0.64
58 0.68
59 0.68
60 0.71
61 0.67
62 0.67
63 0.61
64 0.6
65 0.58
66 0.58