Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q5KLI0

Protein Details
Accession Q5KLI0    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-22AKSIRSKAKMASRARKRNMSHHydrophilic
NLS Segment(s)
PositionSequence
9-17AKMASRARK
78-107GSRKEQWRTARGMSVRPKGSTKAKRNTRRR
Subcellular Location(s) nucl 17, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
KEGG cne:CNB05190  -  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSIRSKAKMASRARKRNMSHYAATEAARTQRLSDKLLGKDKKEDGDNEEVKEERIEGEDAEMKEEPKKISTSGYRGSRKEQWRTARGMSVRPKGSTKAKRNTRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.82
3 0.83
4 0.77
5 0.78
6 0.77
7 0.72
8 0.65
9 0.57
10 0.54
11 0.47
12 0.43
13 0.34
14 0.27
15 0.24
16 0.22
17 0.19
18 0.17
19 0.21
20 0.23
21 0.25
22 0.28
23 0.31
24 0.34
25 0.44
26 0.45
27 0.4
28 0.44
29 0.43
30 0.41
31 0.37
32 0.33
33 0.28
34 0.33
35 0.33
36 0.29
37 0.28
38 0.25
39 0.23
40 0.21
41 0.17
42 0.08
43 0.08
44 0.07
45 0.06
46 0.08
47 0.11
48 0.11
49 0.13
50 0.13
51 0.13
52 0.14
53 0.17
54 0.16
55 0.14
56 0.15
57 0.14
58 0.19
59 0.23
60 0.27
61 0.32
62 0.4
63 0.45
64 0.46
65 0.51
66 0.55
67 0.58
68 0.61
69 0.62
70 0.62
71 0.61
72 0.65
73 0.62
74 0.61
75 0.55
76 0.55
77 0.56
78 0.55
79 0.54
80 0.51
81 0.51
82 0.5
83 0.58
84 0.6
85 0.61
86 0.64
87 0.71