Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B2UHL2

Protein Details
Accession A0A0B2UHL2   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
232-251IVLGLKKKFKKAKGEELLRLHydrophilic
NLS Segment(s)
PositionSequence
235-244GLKKKFKKAK
Subcellular Location(s) nucl 15, cyto_nucl 12, cyto 7, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR029060  PIN-like_dom_sf  
IPR002716  PIN_dom  
Gene Ontology GO:0004540  F:RNA nuclease activity  
Pfam View protein in Pfam  
PF13638  PIN_4  
Amino Acid Sequences MLRISIVPDTNVFMLHLDVIRKLYEDEFPIDVAMSISKVVLQELDHNKSKMTEARKAIRFLEKVYNASITELEGKLKDNSMDVVDGSKLISEVQNNDDKILNFASKQIHPVVLTNDKAFYLKSKCYNVESILMQGLSYEELKIKILGIYTGIEPMDIDEENSKLNEDEKIKELIRDKLLPTILLIMEKSIGKPYVLFFPDDLKAVTLEFLLDLIIKENSLFHSYLPRKSKEIVLGLKKKFKKAKGEELLRLGSELLMMFRIVY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.13
4 0.12
5 0.13
6 0.14
7 0.14
8 0.15
9 0.16
10 0.16
11 0.17
12 0.19
13 0.2
14 0.2
15 0.2
16 0.19
17 0.17
18 0.16
19 0.13
20 0.1
21 0.07
22 0.06
23 0.06
24 0.07
25 0.07
26 0.07
27 0.08
28 0.08
29 0.16
30 0.23
31 0.29
32 0.33
33 0.33
34 0.33
35 0.33
36 0.36
37 0.33
38 0.33
39 0.35
40 0.38
41 0.47
42 0.51
43 0.53
44 0.53
45 0.55
46 0.5
47 0.46
48 0.48
49 0.42
50 0.38
51 0.37
52 0.35
53 0.28
54 0.27
55 0.23
56 0.15
57 0.15
58 0.14
59 0.14
60 0.12
61 0.14
62 0.14
63 0.15
64 0.14
65 0.11
66 0.12
67 0.12
68 0.11
69 0.09
70 0.1
71 0.09
72 0.08
73 0.08
74 0.07
75 0.06
76 0.06
77 0.07
78 0.07
79 0.09
80 0.13
81 0.17
82 0.17
83 0.19
84 0.2
85 0.19
86 0.19
87 0.19
88 0.16
89 0.11
90 0.14
91 0.17
92 0.15
93 0.17
94 0.16
95 0.16
96 0.16
97 0.17
98 0.18
99 0.19
100 0.19
101 0.17
102 0.17
103 0.16
104 0.16
105 0.15
106 0.15
107 0.14
108 0.17
109 0.21
110 0.23
111 0.25
112 0.27
113 0.28
114 0.26
115 0.25
116 0.21
117 0.18
118 0.15
119 0.13
120 0.11
121 0.09
122 0.07
123 0.06
124 0.05
125 0.05
126 0.05
127 0.06
128 0.06
129 0.06
130 0.06
131 0.06
132 0.06
133 0.06
134 0.06
135 0.06
136 0.06
137 0.07
138 0.07
139 0.06
140 0.06
141 0.06
142 0.07
143 0.06
144 0.06
145 0.06
146 0.07
147 0.07
148 0.08
149 0.08
150 0.06
151 0.07
152 0.11
153 0.13
154 0.15
155 0.16
156 0.2
157 0.2
158 0.24
159 0.26
160 0.27
161 0.29
162 0.29
163 0.28
164 0.29
165 0.29
166 0.25
167 0.22
168 0.19
169 0.16
170 0.14
171 0.13
172 0.08
173 0.1
174 0.1
175 0.1
176 0.1
177 0.11
178 0.1
179 0.11
180 0.12
181 0.17
182 0.18
183 0.19
184 0.17
185 0.2
186 0.21
187 0.21
188 0.2
189 0.13
190 0.13
191 0.12
192 0.12
193 0.08
194 0.07
195 0.06
196 0.05
197 0.05
198 0.05
199 0.05
200 0.06
201 0.07
202 0.06
203 0.07
204 0.08
205 0.1
206 0.13
207 0.13
208 0.11
209 0.22
210 0.26
211 0.35
212 0.41
213 0.42
214 0.42
215 0.44
216 0.49
217 0.45
218 0.49
219 0.5
220 0.54
221 0.6
222 0.63
223 0.7
224 0.69
225 0.72
226 0.72
227 0.7
228 0.71
229 0.71
230 0.76
231 0.77
232 0.81
233 0.78
234 0.76
235 0.71
236 0.6
237 0.52
238 0.41
239 0.3
240 0.22
241 0.15
242 0.1
243 0.08