Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B2UMS8

Protein Details
Accession A0A0B2UMS8    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
141-160GINKKKQNTKCLDKIKNVTVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 14, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012173  Mpp10  
Gene Ontology GO:0034457  C:Mpp10 complex  
GO:0005732  C:sno(s)RNA-containing ribonucleoprotein complex  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF04006  Mpp10  
Amino Acid Sequences MNSERIEEIEKFLVKDKEWKHMGEVDKSKRPKDSLLAQKEIDFRQGPPLVPFSSKQNDEIERVTLKRIREGTFDNYEYKTKHVVEVVDAVDDVNEVECEETKDIISLYNEIEGDLMNMVDFGNNGFVPDAEVRSVRIEEAGINKKKQNTKCLDKIKNVTVIKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.37
3 0.35
4 0.39
5 0.41
6 0.41
7 0.38
8 0.42
9 0.45
10 0.46
11 0.52
12 0.51
13 0.56
14 0.6
15 0.6
16 0.58
17 0.56
18 0.51
19 0.48
20 0.5
21 0.52
22 0.54
23 0.55
24 0.51
25 0.52
26 0.52
27 0.46
28 0.41
29 0.32
30 0.25
31 0.28
32 0.29
33 0.26
34 0.24
35 0.27
36 0.23
37 0.24
38 0.24
39 0.22
40 0.26
41 0.26
42 0.27
43 0.28
44 0.29
45 0.29
46 0.29
47 0.26
48 0.22
49 0.22
50 0.23
51 0.22
52 0.21
53 0.23
54 0.26
55 0.24
56 0.25
57 0.28
58 0.3
59 0.31
60 0.33
61 0.3
62 0.28
63 0.28
64 0.26
65 0.24
66 0.22
67 0.17
68 0.16
69 0.16
70 0.14
71 0.13
72 0.15
73 0.14
74 0.1
75 0.1
76 0.09
77 0.07
78 0.07
79 0.06
80 0.03
81 0.03
82 0.03
83 0.03
84 0.04
85 0.05
86 0.06
87 0.06
88 0.06
89 0.07
90 0.07
91 0.08
92 0.09
93 0.08
94 0.08
95 0.09
96 0.09
97 0.09
98 0.09
99 0.07
100 0.07
101 0.06
102 0.05
103 0.04
104 0.04
105 0.04
106 0.04
107 0.04
108 0.04
109 0.05
110 0.05
111 0.06
112 0.06
113 0.06
114 0.09
115 0.1
116 0.11
117 0.1
118 0.11
119 0.12
120 0.14
121 0.15
122 0.12
123 0.12
124 0.11
125 0.12
126 0.2
127 0.29
128 0.32
129 0.35
130 0.39
131 0.46
132 0.55
133 0.59
134 0.61
135 0.61
136 0.65
137 0.72
138 0.79
139 0.79
140 0.8
141 0.81
142 0.77
143 0.77