Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B2UMB7

Protein Details
Accession A0A0B2UMB7    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
6-51IHKGRTYKTRSNVRTKVRTPSGKLVNRRVKKNAKKHRCHECNKELSHydrophilic
NLS Segment(s)
PositionSequence
20-41TKVRTPSGKLVNRRVKKNAKKH
Subcellular Location(s) nucl 14, mito 8, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008195  Ribosomal_L34Ae  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01199  Ribosomal_L34e  
Amino Acid Sequences MKNVLIHKGRTYKTRSNVRTKVRTPSGKLVNRRVKKNAKKHRCHECNKELSSIARLRPAEFSRQKVSARRVNRVYGATICGRCVEDKIIGAFLADEERIVKEKIGMTASN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.7
3 0.72
4 0.78
5 0.8
6 0.81
7 0.76
8 0.77
9 0.75
10 0.74
11 0.7
12 0.7
13 0.7
14 0.68
15 0.71
16 0.72
17 0.73
18 0.73
19 0.73
20 0.73
21 0.74
22 0.76
23 0.8
24 0.81
25 0.81
26 0.84
27 0.87
28 0.88
29 0.87
30 0.86
31 0.84
32 0.82
33 0.79
34 0.71
35 0.65
36 0.54
37 0.45
38 0.42
39 0.35
40 0.26
41 0.23
42 0.22
43 0.2
44 0.24
45 0.24
46 0.29
47 0.3
48 0.33
49 0.32
50 0.35
51 0.37
52 0.39
53 0.45
54 0.43
55 0.44
56 0.48
57 0.48
58 0.47
59 0.48
60 0.43
61 0.39
62 0.32
63 0.31
64 0.27
65 0.24
66 0.22
67 0.2
68 0.19
69 0.17
70 0.18
71 0.17
72 0.14
73 0.15
74 0.15
75 0.15
76 0.14
77 0.13
78 0.11
79 0.09
80 0.1
81 0.08
82 0.07
83 0.07
84 0.09
85 0.12
86 0.13
87 0.13
88 0.14
89 0.17
90 0.21