Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0B2UD97

Protein Details
Accession A0A0B2UD97    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MGRKKVRRKVNMPRKQTKLERQFNCHydrophilic
NLS Segment(s)
PositionSequence
3-14RKKVRRKVNMPR
Subcellular Location(s) mito 13, nucl 8.5, cyto_nucl 6.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGRKKVRRKVNMPRKQTKLERQFNCPMCSHENVVQCVIKKMQMKGIARCSVCEASFMCDIDKLTTGIDVYSAWVDSCSKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.85
3 0.84
4 0.83
5 0.82
6 0.83
7 0.76
8 0.74
9 0.76
10 0.72
11 0.66
12 0.56
13 0.49
14 0.43
15 0.41
16 0.37
17 0.33
18 0.32
19 0.3
20 0.31
21 0.28
22 0.25
23 0.24
24 0.21
25 0.2
26 0.19
27 0.18
28 0.21
29 0.26
30 0.29
31 0.32
32 0.38
33 0.39
34 0.37
35 0.36
36 0.36
37 0.31
38 0.28
39 0.25
40 0.19
41 0.17
42 0.19
43 0.19
44 0.15
45 0.14
46 0.15
47 0.14
48 0.15
49 0.12
50 0.1
51 0.1
52 0.1
53 0.09
54 0.09
55 0.07
56 0.08
57 0.08
58 0.08
59 0.08
60 0.09