Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B2UL81

Protein Details
Accession A0A0B2UL81   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
67-90VTGSKNKGAKKRRKQVSRRLGNVFHydrophilic
NLS Segment(s)
PositionSequence
71-84KNKGAKKRRKQVSR
Subcellular Location(s) nucl 13, cyto_nucl 11.333, mito_nucl 8.833, cyto 8.5, mito 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010920  LSM_dom_sf  
IPR047575  Sm  
IPR040002  Sm-like_LSM3  
IPR001163  Sm_dom_euk/arc  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF01423  LSM  
PROSITE View protein in PROSITE  
PS52002  SM  
Amino Acid Sequences MFLPTNASPGEKEAMEMKGPLMLIRRCMVTKKPVIVSLRNNRKVIGCVVAYDRHYNMILMDAVETGVTGSKNKGAKKRRKQVSRRLGNVFVRGDTVVLVASGVGSASHAQKTIDESQSEDKQQLRNTADSEQQPYN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.18
4 0.16
5 0.15
6 0.15
7 0.15
8 0.18
9 0.17
10 0.19
11 0.2
12 0.23
13 0.22
14 0.26
15 0.29
16 0.31
17 0.35
18 0.38
19 0.38
20 0.42
21 0.44
22 0.47
23 0.52
24 0.54
25 0.6
26 0.61
27 0.59
28 0.54
29 0.51
30 0.47
31 0.4
32 0.33
33 0.22
34 0.17
35 0.19
36 0.2
37 0.2
38 0.2
39 0.19
40 0.16
41 0.16
42 0.15
43 0.12
44 0.11
45 0.09
46 0.07
47 0.07
48 0.05
49 0.05
50 0.05
51 0.05
52 0.03
53 0.04
54 0.04
55 0.04
56 0.05
57 0.09
58 0.13
59 0.17
60 0.26
61 0.35
62 0.46
63 0.56
64 0.66
65 0.72
66 0.79
67 0.84
68 0.87
69 0.88
70 0.87
71 0.82
72 0.77
73 0.74
74 0.66
75 0.62
76 0.52
77 0.41
78 0.33
79 0.26
80 0.21
81 0.14
82 0.12
83 0.07
84 0.05
85 0.05
86 0.03
87 0.03
88 0.03
89 0.03
90 0.02
91 0.03
92 0.05
93 0.07
94 0.08
95 0.09
96 0.09
97 0.1
98 0.16
99 0.21
100 0.24
101 0.22
102 0.25
103 0.32
104 0.36
105 0.37
106 0.35
107 0.32
108 0.34
109 0.38
110 0.42
111 0.39
112 0.38
113 0.39
114 0.4
115 0.43
116 0.42