Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B2UCT2

Protein Details
Accession A0A0B2UCT2    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
52-73AYSLYKLKKYKKALRILKWIDSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR031545  SRP_TPR-like  
IPR011990  TPR-like_helical_dom_sf  
Gene Ontology GO:0005783  C:endoplasmic reticulum  
GO:1990904  C:ribonucleoprotein complex  
Pfam View protein in Pfam  
PF17004  SRP_TPR_like  
Amino Acid Sequences MDIYELVRNDQHEQIYAVEHPEFGRFRAVACIFLGRYEEALKYAERKSFEAAYSLYKLKKYKKALRILKWIDSEGSRVLSSQCLFYLGYYGSAYKMLSKIKMDDDVAVNLQAMKSMAILADKNLYEYGNRFQIRKMDDVDGFDDIKEYNMKSAEGRVDLVFNESFEHLFDEKRFLEFLKMQAVKAEMKGTIVEEQLKNVCGQEVCIPLLSKSQKKTVEYNEGIIDAISMPIHFQRNFARYNVLETKYKSNECAWIDMAYIKDENGKYRLNEGVDIAKIPAISAKMVLLRILVMWKNGKSNRRIASEIKRLPEEVANKYLSVFEPGKVVDRNTYVKISKELMN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.24
3 0.23
4 0.22
5 0.18
6 0.17
7 0.16
8 0.21
9 0.21
10 0.19
11 0.23
12 0.2
13 0.2
14 0.28
15 0.28
16 0.24
17 0.24
18 0.28
19 0.23
20 0.24
21 0.25
22 0.17
23 0.18
24 0.18
25 0.17
26 0.14
27 0.16
28 0.16
29 0.19
30 0.22
31 0.25
32 0.25
33 0.27
34 0.3
35 0.31
36 0.31
37 0.29
38 0.26
39 0.27
40 0.28
41 0.31
42 0.29
43 0.31
44 0.36
45 0.42
46 0.49
47 0.55
48 0.61
49 0.66
50 0.74
51 0.79
52 0.82
53 0.84
54 0.81
55 0.77
56 0.7
57 0.62
58 0.53
59 0.44
60 0.38
61 0.28
62 0.25
63 0.18
64 0.16
65 0.15
66 0.16
67 0.16
68 0.15
69 0.13
70 0.13
71 0.13
72 0.12
73 0.14
74 0.1
75 0.11
76 0.1
77 0.11
78 0.1
79 0.1
80 0.1
81 0.1
82 0.13
83 0.14
84 0.16
85 0.18
86 0.2
87 0.21
88 0.24
89 0.23
90 0.22
91 0.21
92 0.2
93 0.19
94 0.16
95 0.14
96 0.12
97 0.11
98 0.09
99 0.07
100 0.05
101 0.05
102 0.05
103 0.05
104 0.06
105 0.06
106 0.07
107 0.09
108 0.09
109 0.1
110 0.1
111 0.1
112 0.1
113 0.12
114 0.14
115 0.19
116 0.2
117 0.2
118 0.21
119 0.26
120 0.28
121 0.29
122 0.29
123 0.24
124 0.24
125 0.25
126 0.25
127 0.22
128 0.19
129 0.16
130 0.14
131 0.1
132 0.1
133 0.09
134 0.08
135 0.08
136 0.09
137 0.09
138 0.09
139 0.11
140 0.12
141 0.12
142 0.13
143 0.11
144 0.11
145 0.11
146 0.13
147 0.1
148 0.09
149 0.09
150 0.08
151 0.08
152 0.07
153 0.1
154 0.08
155 0.09
156 0.09
157 0.12
158 0.12
159 0.12
160 0.12
161 0.1
162 0.13
163 0.13
164 0.14
165 0.19
166 0.19
167 0.19
168 0.2
169 0.21
170 0.19
171 0.18
172 0.18
173 0.1
174 0.09
175 0.1
176 0.1
177 0.1
178 0.1
179 0.13
180 0.12
181 0.13
182 0.13
183 0.14
184 0.13
185 0.12
186 0.12
187 0.08
188 0.09
189 0.11
190 0.12
191 0.12
192 0.13
193 0.13
194 0.12
195 0.18
196 0.22
197 0.23
198 0.23
199 0.3
200 0.34
201 0.36
202 0.42
203 0.42
204 0.47
205 0.44
206 0.44
207 0.37
208 0.33
209 0.3
210 0.24
211 0.18
212 0.08
213 0.07
214 0.05
215 0.04
216 0.04
217 0.07
218 0.12
219 0.11
220 0.14
221 0.19
222 0.23
223 0.25
224 0.26
225 0.28
226 0.24
227 0.31
228 0.36
229 0.33
230 0.33
231 0.34
232 0.41
233 0.41
234 0.42
235 0.37
236 0.32
237 0.36
238 0.34
239 0.34
240 0.28
241 0.23
242 0.23
243 0.22
244 0.21
245 0.16
246 0.15
247 0.12
248 0.16
249 0.16
250 0.19
251 0.21
252 0.24
253 0.23
254 0.26
255 0.3
256 0.25
257 0.25
258 0.24
259 0.24
260 0.21
261 0.21
262 0.18
263 0.15
264 0.13
265 0.12
266 0.13
267 0.1
268 0.09
269 0.09
270 0.1
271 0.12
272 0.12
273 0.13
274 0.11
275 0.1
276 0.1
277 0.14
278 0.14
279 0.16
280 0.2
281 0.21
282 0.3
283 0.36
284 0.42
285 0.43
286 0.51
287 0.54
288 0.55
289 0.58
290 0.58
291 0.62
292 0.65
293 0.66
294 0.62
295 0.58
296 0.53
297 0.51
298 0.49
299 0.45
300 0.4
301 0.39
302 0.35
303 0.33
304 0.32
305 0.32
306 0.26
307 0.27
308 0.23
309 0.18
310 0.2
311 0.21
312 0.25
313 0.26
314 0.27
315 0.26
316 0.3
317 0.34
318 0.34
319 0.4
320 0.37
321 0.38
322 0.41