Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0B2ULC6

Protein Details
Accession A0A0B2ULC6    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
93-126TRTEIKIKARRVRKDERKKSYKMFGTLRRNTRKABasic
NLS Segment(s)
PositionSequence
97-132IKIKARRVRKDERKKSYKMFGTLRRNTRKAEKRSNK
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
Amino Acid Sequences MSLELEITGMRDNKLLSRKELEVVAHHPGMACPSKEEVRDKISELYQTNKKNIVIAGMNNRYGTHRSMMNARIYASADMLTQIEKKNIVAKMTRTEIKIKARRVRKDERKKSYKMFGTLRRNTRKAEKRSNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.29
3 0.3
4 0.33
5 0.35
6 0.35
7 0.37
8 0.32
9 0.29
10 0.29
11 0.3
12 0.25
13 0.23
14 0.21
15 0.18
16 0.21
17 0.21
18 0.18
19 0.15
20 0.18
21 0.21
22 0.24
23 0.28
24 0.28
25 0.29
26 0.3
27 0.3
28 0.29
29 0.28
30 0.29
31 0.26
32 0.29
33 0.32
34 0.33
35 0.34
36 0.34
37 0.33
38 0.29
39 0.28
40 0.25
41 0.19
42 0.18
43 0.23
44 0.22
45 0.23
46 0.22
47 0.22
48 0.21
49 0.21
50 0.2
51 0.14
52 0.12
53 0.13
54 0.16
55 0.19
56 0.2
57 0.19
58 0.18
59 0.17
60 0.17
61 0.16
62 0.13
63 0.1
64 0.08
65 0.08
66 0.07
67 0.07
68 0.08
69 0.09
70 0.1
71 0.1
72 0.1
73 0.15
74 0.17
75 0.19
76 0.2
77 0.22
78 0.26
79 0.31
80 0.33
81 0.3
82 0.33
83 0.37
84 0.44
85 0.49
86 0.52
87 0.56
88 0.63
89 0.69
90 0.73
91 0.78
92 0.79
93 0.83
94 0.85
95 0.87
96 0.87
97 0.85
98 0.84
99 0.83
100 0.79
101 0.76
102 0.74
103 0.73
104 0.75
105 0.77
106 0.8
107 0.8
108 0.76
109 0.74
110 0.76
111 0.76
112 0.75