Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B2UJ15

Protein Details
Accession A0A0B2UJ15   
Localization Confidence Low
Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
77-98YLFDKPPRYRRSIPNGKKQIRDHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 17, nucl 15.5, cyto 11.5
Family & Domain DBs
Amino Acid Sequences MQILTDEESDIEVLELQGDVENMDAFDGHFNKDLVQLEFPTFILQGRKIHKELSILQRDVVNSIPCIKLVRKLKTVYLFDKPPRYRRSIPNGKKQIRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.05
4 0.05
5 0.05
6 0.05
7 0.05
8 0.05
9 0.05
10 0.05
11 0.04
12 0.04
13 0.08
14 0.09
15 0.1
16 0.11
17 0.11
18 0.12
19 0.16
20 0.17
21 0.15
22 0.16
23 0.15
24 0.14
25 0.15
26 0.15
27 0.12
28 0.1
29 0.09
30 0.1
31 0.11
32 0.15
33 0.18
34 0.22
35 0.22
36 0.23
37 0.23
38 0.24
39 0.28
40 0.33
41 0.35
42 0.32
43 0.32
44 0.32
45 0.31
46 0.29
47 0.25
48 0.17
49 0.11
50 0.14
51 0.13
52 0.12
53 0.15
54 0.14
55 0.2
56 0.28
57 0.33
58 0.37
59 0.39
60 0.44
61 0.5
62 0.54
63 0.51
64 0.5
65 0.51
66 0.52
67 0.6
68 0.6
69 0.61
70 0.62
71 0.66
72 0.66
73 0.69
74 0.74
75 0.75
76 0.78
77 0.8
78 0.85