Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B2UFN4

Protein Details
Accession A0A0B2UFN4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
58-77LAIDREAEKKNRRERKMKNKBasic
NLS Segment(s)
PositionSequence
65-77EKKNRRERKMKNK
Subcellular Location(s) plas 13, mito 6, E.R. 5, pero 1, golg 1, vacu 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MIAEKRRFYTKLFICVGVMFVSPLVVHAVGRLSGSDSPLLSFGSLILVLGSMGMICKLAIDREAEKKNRRERKMKNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.37
3 0.35
4 0.25
5 0.19
6 0.11
7 0.08
8 0.07
9 0.06
10 0.06
11 0.06
12 0.05
13 0.05
14 0.05
15 0.06
16 0.06
17 0.06
18 0.06
19 0.06
20 0.07
21 0.08
22 0.08
23 0.07
24 0.08
25 0.08
26 0.08
27 0.06
28 0.05
29 0.05
30 0.04
31 0.04
32 0.04
33 0.03
34 0.03
35 0.03
36 0.03
37 0.03
38 0.02
39 0.02
40 0.02
41 0.03
42 0.02
43 0.03
44 0.04
45 0.05
46 0.06
47 0.1
48 0.13
49 0.22
50 0.3
51 0.38
52 0.46
53 0.55
54 0.64
55 0.72
56 0.77
57 0.79