Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P0CR80

Protein Details
Accession P0CR80   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
101-121IIKRSERTKRKHQTHIQNLELHydrophilic
NLS Segment(s)
PositionSequence
79-111KLEKKAAKKAEAEAKKKEQTKIIIKRSERTKRK
Subcellular Location(s) cyto 15, cyto_nucl 11.166, cyto_mito 10.666, mito_nucl 6.166, nucl 6, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR046447  DENR_C  
IPR005873  DENR_eukaryotes  
IPR001950  SUI1  
IPR036877  SUI1_dom_sf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003729  F:mRNA binding  
GO:0003743  F:translation initiation factor activity  
GO:0001731  P:formation of translation preinitiation complex  
GO:0002188  P:translation reinitiation  
KEGG cne:CNE00790  -  
Pfam View protein in Pfam  
PF01253  SUI1  
PROSITE View protein in PROSITE  
PS50296  SUI1  
CDD cd11607  DENR_C  
Amino Acid Sequences MASAVSGPSTKQVHPFYCAVCSLPTEYCEFGPSVSKCKAWLEEQDKDEYERVWGEGALASRIGTLSLDKQEKLEADAAKLEKKAAKKAEAEAKKKEQTKIIIKRSERTKRKHQTHIQNLELFGVDLKKAAKQFAGKFATGSSVSKTPQGEEEIVIQGDVGDEIVEMIRQQVGALKGVPADQITRVEVKKKKEAEEPAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.36
4 0.36
5 0.35
6 0.29
7 0.23
8 0.23
9 0.21
10 0.19
11 0.19
12 0.19
13 0.19
14 0.18
15 0.19
16 0.17
17 0.15
18 0.21
19 0.21
20 0.24
21 0.25
22 0.25
23 0.25
24 0.29
25 0.31
26 0.27
27 0.36
28 0.37
29 0.41
30 0.43
31 0.46
32 0.43
33 0.42
34 0.39
35 0.3
36 0.24
37 0.18
38 0.16
39 0.12
40 0.11
41 0.09
42 0.1
43 0.1
44 0.09
45 0.09
46 0.08
47 0.07
48 0.08
49 0.07
50 0.05
51 0.06
52 0.08
53 0.13
54 0.15
55 0.15
56 0.16
57 0.17
58 0.17
59 0.18
60 0.21
61 0.15
62 0.14
63 0.18
64 0.18
65 0.18
66 0.18
67 0.18
68 0.16
69 0.18
70 0.24
71 0.24
72 0.27
73 0.27
74 0.31
75 0.39
76 0.45
77 0.47
78 0.46
79 0.49
80 0.51
81 0.53
82 0.5
83 0.45
84 0.43
85 0.49
86 0.52
87 0.54
88 0.55
89 0.52
90 0.57
91 0.62
92 0.66
93 0.64
94 0.61
95 0.65
96 0.68
97 0.75
98 0.79
99 0.79
100 0.79
101 0.82
102 0.83
103 0.76
104 0.67
105 0.59
106 0.49
107 0.4
108 0.29
109 0.19
110 0.12
111 0.07
112 0.07
113 0.07
114 0.09
115 0.1
116 0.11
117 0.13
118 0.18
119 0.2
120 0.28
121 0.31
122 0.29
123 0.28
124 0.27
125 0.28
126 0.23
127 0.22
128 0.16
129 0.15
130 0.16
131 0.19
132 0.19
133 0.17
134 0.19
135 0.21
136 0.19
137 0.18
138 0.2
139 0.18
140 0.17
141 0.16
142 0.13
143 0.1
144 0.09
145 0.08
146 0.05
147 0.03
148 0.03
149 0.03
150 0.04
151 0.04
152 0.04
153 0.04
154 0.05
155 0.05
156 0.05
157 0.09
158 0.11
159 0.12
160 0.13
161 0.13
162 0.13
163 0.14
164 0.15
165 0.12
166 0.12
167 0.12
168 0.14
169 0.16
170 0.21
171 0.23
172 0.31
173 0.36
174 0.41
175 0.48
176 0.52
177 0.55
178 0.58