Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B1NUS1

Protein Details
Accession A0A0B1NUS1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
25-51ISFGHICAKKKKKKKKKKGLLGLSSVAHydrophilic
NLS Segment(s)
PositionSequence
33-43KKKKKKKKKKG
Subcellular Location(s) plas 6, cyto 5, mito 4, extr 4, vacu 4, pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTLGFVLEAICPIKPRPAIKMETNISFGHICAKKKKKKKKKKGLLGLSSVAVAVAVAAVAAAAAAASNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.26
4 0.31
5 0.36
6 0.38
7 0.45
8 0.43
9 0.41
10 0.41
11 0.36
12 0.32
13 0.27
14 0.23
15 0.23
16 0.23
17 0.23
18 0.3
19 0.4
20 0.47
21 0.57
22 0.68
23 0.71
24 0.79
25 0.88
26 0.9
27 0.92
28 0.94
29 0.95
30 0.94
31 0.89
32 0.82
33 0.73
34 0.61
35 0.5
36 0.39
37 0.28
38 0.17
39 0.1
40 0.05
41 0.03
42 0.02
43 0.02
44 0.02
45 0.02
46 0.02
47 0.02
48 0.01
49 0.01