FuNGI

A0A0B1PBN3

Protein Details

Accession

A0A0B1PBN3

Localization Confidence

Low

Confidence Score

5.8

NoLS Segment(s)

Position	Sequence	Protein Nature
287-306	GFHHKKPWFKYKPYHKHPYF	Basic

NLS Segment(s)

Subcellular Location(s)

extr 12, cyto 5.5, mito 5, cyto_nucl 4.5, nucl 2.5

Family & Domain DBs

InterPro	View protein in InterPro IPR029058 AB_hydrolase IPR000675 Cutinase/axe IPR011150 Cutinase_monf
Gene Ontology	GO:0005576 C:extracellular region GO:0050525 F:cutinase activity
Pfam	View protein in Pfam PF01083 Cutinase

Amino Acid Sequences

MRSAMFLKNYFVNITINPRRLLVISLLVSTCVQGQKDVDSKCKNLGPNSNSVCESQTMLFAFEDDKSNSNTTKIDEKDVTANDLDERNNNGNCSSVGVIYARGLSEPGNLGILTGPPFFDAIDNKVENEDVAIQGVNYPDSKPSDEVEGSPEAVKVPPEAAKELARIITESRNKCPDMHLIVSGYSEGSQVVHEATDQLSPEISNGIGAIIMFGDPMKGTPIKNYDAKKVLTVCHDGDVICDGKPEVRPPHLTYSQDANDAAEFAVKTMGHIGITSYDHTFCKFCNGFHHKKPWFKYKPYHKHPYFYRPRPYHYHYGFGYGYGYGYGYGYGWGYKHGSSADSANMQSSPEEPSANPDKPSANSGEPSANPDKPSANPDKPSASPDKPSANSGEPSANPDKPSANPDKPSASPDKPSANSGEPSANPDKPSANPDKPSASPDKPSANSGEAPAKPGSSTSVPEGASTETEKSAITSMRRLKRRNRV

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.32
2	0.37
3	0.38
4	0.37
5	0.36
6	0.37
7	0.35
8	0.34
9	0.27
10	0.25
11	0.22
12	0.23
13	0.22
14	0.22
15	0.21
16	0.19
17	0.2
18	0.17
19	0.16
20	0.16
21	0.17
22	0.22
23	0.29
24	0.32
25	0.38
26	0.4
27	0.42
28	0.46
29	0.5
30	0.48
31	0.49
32	0.55
33	0.5
34	0.55
35	0.57
36	0.55
37	0.51
38	0.47
39	0.42
40	0.33
41	0.31
42	0.22
43	0.21
44	0.17
45	0.18
46	0.16
47	0.15
48	0.15
49	0.14
50	0.17
51	0.16
52	0.17
53	0.19
54	0.22
55	0.23
56	0.24
57	0.24
58	0.23
59	0.29
60	0.29
61	0.32
62	0.31
63	0.32
64	0.36
65	0.36
66	0.36
67	0.28
68	0.27
69	0.23
70	0.24
71	0.23
72	0.19
73	0.23
74	0.26
75	0.27
76	0.27
77	0.25
78	0.23
79	0.22
80	0.22
81	0.18
82	0.12
83	0.12
84	0.12
85	0.12
86	0.11
87	0.12
88	0.09
89	0.08
90	0.09
91	0.08
92	0.09
93	0.09
94	0.09
95	0.09
96	0.09
97	0.09
98	0.09
99	0.1
100	0.1
101	0.09
102	0.09
103	0.08
104	0.09
105	0.08
106	0.1
107	0.11
108	0.11
109	0.17
110	0.17
111	0.17
112	0.18
113	0.17
114	0.15
115	0.15
116	0.13
117	0.07
118	0.07
119	0.07
120	0.06
121	0.08
122	0.08
123	0.08
124	0.08
125	0.08
126	0.1
127	0.13
128	0.15
129	0.15
130	0.15
131	0.19
132	0.19
133	0.19
134	0.2
135	0.19
136	0.18
137	0.17
138	0.16
139	0.12
140	0.12
141	0.12
142	0.09
143	0.09
144	0.12
145	0.13
146	0.14
147	0.16
148	0.16
149	0.17
150	0.17
151	0.17
152	0.14
153	0.13
154	0.14
155	0.19
156	0.26
157	0.28
158	0.31
159	0.35
160	0.36
161	0.36
162	0.36
163	0.35
164	0.32
165	0.31
166	0.27
167	0.23
168	0.23
169	0.22
170	0.19
171	0.13
172	0.08
173	0.07
174	0.05
175	0.05
176	0.05
177	0.05
178	0.05
179	0.05
180	0.04
181	0.05
182	0.06
183	0.06
184	0.07
185	0.06
186	0.06
187	0.06
188	0.06
189	0.06
190	0.05
191	0.04
192	0.04
193	0.04
194	0.04
195	0.03
196	0.03
197	0.03
198	0.03
199	0.03
200	0.03
201	0.03
202	0.03
203	0.03
204	0.05
205	0.07
206	0.07
207	0.1
208	0.14
209	0.17
210	0.23
211	0.25
212	0.28
213	0.31
214	0.31
215	0.31
216	0.29
217	0.28
218	0.25
219	0.26
220	0.22
221	0.18
222	0.18
223	0.16
224	0.14
225	0.14
226	0.12
227	0.08
228	0.08
229	0.07
230	0.08
231	0.09
232	0.13
233	0.14
234	0.16
235	0.2
236	0.23
237	0.3
238	0.32
239	0.32
240	0.3
241	0.32
242	0.3
243	0.28
244	0.25
245	0.19
246	0.15
247	0.14
248	0.12
249	0.07
250	0.06
251	0.05
252	0.07
253	0.06
254	0.06
255	0.07
256	0.07
257	0.06
258	0.06
259	0.06
260	0.07
261	0.08
262	0.09
263	0.09
264	0.1
265	0.1
266	0.11
267	0.12
268	0.1
269	0.17
270	0.17
271	0.17
272	0.26
273	0.34
274	0.4
275	0.46
276	0.56
277	0.54
278	0.61
279	0.66
280	0.67
281	0.66
282	0.66
283	0.7
284	0.71
285	0.76
286	0.78
287	0.83
288	0.75
289	0.75
290	0.74
291	0.75
292	0.74
293	0.72
294	0.73
295	0.66
296	0.69
297	0.68
298	0.69
299	0.68
300	0.59
301	0.56
302	0.46
303	0.48
304	0.42
305	0.35
306	0.29
307	0.19
308	0.17
309	0.11
310	0.11
311	0.05
312	0.05
313	0.05
314	0.05
315	0.05
316	0.05
317	0.06
318	0.06
319	0.07
320	0.09
321	0.09
322	0.1
323	0.1
324	0.11
325	0.11
326	0.13
327	0.13
328	0.14
329	0.14
330	0.13
331	0.13
332	0.13
333	0.12
334	0.11
335	0.13
336	0.12
337	0.13
338	0.12
339	0.18
340	0.24
341	0.26
342	0.27
343	0.25
344	0.26
345	0.26
346	0.29
347	0.27
348	0.23
349	0.22
350	0.23
351	0.25
352	0.23
353	0.28
354	0.3
355	0.28
356	0.27
357	0.28
358	0.28
359	0.26
360	0.33
361	0.36
362	0.36
363	0.37
364	0.4
365	0.42
366	0.41
367	0.45
368	0.46
369	0.4
370	0.39
371	0.41
372	0.45
373	0.41
374	0.43
375	0.42
376	0.38
377	0.35
378	0.33
379	0.32
380	0.25
381	0.3
382	0.32
383	0.3
384	0.27
385	0.28
386	0.28
387	0.26
388	0.33
389	0.36
390	0.36
391	0.37
392	0.4
393	0.42
394	0.41
395	0.45
396	0.46
397	0.4
398	0.39
399	0.41
400	0.45
401	0.41
402	0.43
403	0.42
404	0.38
405	0.35
406	0.33
407	0.32
408	0.25
409	0.3
410	0.32
411	0.3
412	0.27
413	0.28
414	0.28
415	0.26
416	0.33
417	0.36
418	0.36
419	0.37
420	0.4
421	0.42
422	0.41
423	0.45
424	0.46
425	0.4
426	0.39
427	0.41
428	0.45
429	0.41
430	0.43
431	0.41
432	0.37
433	0.35
434	0.35
435	0.38
436	0.31
437	0.34
438	0.32
439	0.28
440	0.25
441	0.24
442	0.25
443	0.2
444	0.22
445	0.22
446	0.26
447	0.26
448	0.26
449	0.27
450	0.24
451	0.23
452	0.23
453	0.21
454	0.17
455	0.17
456	0.17
457	0.16
458	0.18
459	0.2
460	0.21
461	0.28
462	0.37
463	0.46
464	0.55
465	0.62

A0A0B1PBN3

3D AlphaFold-predicted Structure Viewer