Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B1P410

Protein Details
Accession A0A0B1P410    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
10-34PEKFLCRVCTKWKRKTQFSNKELGKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR024630  Stc1  
Pfam View protein in Pfam  
PF12898  Stc1  
Amino Acid Sequences MSKRQSVKLPEKFLCRVCTKWKRKTQFSNKELGKFTFRNQNSATQVTPITAKLRCRGCTGEAAHELECLGPCAKTKLLNEFSKAARKSGGSNVFCELIYL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.56
3 0.52
4 0.54
5 0.6
6 0.63
7 0.68
8 0.73
9 0.76
10 0.81
11 0.88
12 0.88
13 0.88
14 0.82
15 0.82
16 0.75
17 0.72
18 0.65
19 0.56
20 0.51
21 0.41
22 0.4
23 0.4
24 0.37
25 0.36
26 0.35
27 0.38
28 0.35
29 0.36
30 0.33
31 0.25
32 0.24
33 0.2
34 0.19
35 0.13
36 0.12
37 0.13
38 0.14
39 0.18
40 0.22
41 0.24
42 0.26
43 0.27
44 0.26
45 0.3
46 0.31
47 0.3
48 0.28
49 0.29
50 0.26
51 0.23
52 0.22
53 0.16
54 0.14
55 0.11
56 0.09
57 0.07
58 0.08
59 0.11
60 0.12
61 0.17
62 0.19
63 0.27
64 0.34
65 0.37
66 0.39
67 0.41
68 0.43
69 0.47
70 0.46
71 0.38
72 0.33
73 0.32
74 0.32
75 0.37
76 0.43
77 0.36
78 0.37
79 0.39
80 0.37