Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B1P9K6

Protein Details
Accession A0A0B1P9K6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
59-81CGYPSQNAKHVQKKKKMPRVGKGHydrophilic
NLS Segment(s)
PositionSequence
115-126QKKKKMPRVGKG
Subcellular Location(s) mito 24, mito_nucl 13.333, cyto_mito 12.833
Family & Domain DBs
Amino Acid Sequences MSILVFAKFRLTSVITFKIMKVSRAQSSIAIQIRSEHLGLNSYLHRRGVPGVENPKCQCGYPSQNAKHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVQKKKKMPRVGKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.26
3 0.27
4 0.26
5 0.32
6 0.3
7 0.29
8 0.29
9 0.29
10 0.3
11 0.31
12 0.32
13 0.25
14 0.25
15 0.3
16 0.28
17 0.24
18 0.2
19 0.2
20 0.2
21 0.2
22 0.18
23 0.12
24 0.09
25 0.1
26 0.1
27 0.11
28 0.12
29 0.12
30 0.13
31 0.13
32 0.13
33 0.12
34 0.13
35 0.14
36 0.15
37 0.2
38 0.29
39 0.31
40 0.37
41 0.37
42 0.4
43 0.38
44 0.35
45 0.3
46 0.28
47 0.33
48 0.37
49 0.46
50 0.46
51 0.53
52 0.61
53 0.67
54 0.69
55 0.72
56 0.72
57 0.72
58 0.8
59 0.83
60 0.86
61 0.88