Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0B1P4Z8

Protein Details
Accession A0A0B1P4Z8    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
152-172EGYRKEGGKRRNKQDEHHSSLBasic
NLS Segment(s)
PositionSequence
156-163KEGGKRRN
Subcellular Location(s) nucl 12.5, cyto_nucl 11.833, cyto 10, cyto_mito 6.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR044613  Nep1/2-like  
IPR038765  Papain-like_cys_pep_sf  
IPR003653  Peptidase_C48_C  
Gene Ontology GO:0008234  F:cysteine-type peptidase activity  
GO:0019784  F:deNEDDylase activity  
GO:0006508  P:proteolysis  
Pfam View protein in Pfam  
PF02902  Peptidase_C48  
PROSITE View protein in PROSITE  
PS50600  ULP_PROTEASE  
Amino Acid Sequences MAFMLMQTPNPLTVKDALPDFSQTTHVFLPINDARSVTLAEGGSHWSLLLVSIIDGTAFHYDSLMPSNYNEARLATNKLSILIGRNLQFVNLDDSPQQENSNDCGIYVCIQMRYLLLKRILSANSHEKVSMSLGGKLVDANGGRKEILKTIEGYRKEGGKRRNKQDEHHSSLSFGKRKSNSGSPPRIDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.22
4 0.21
5 0.21
6 0.24
7 0.22
8 0.19
9 0.22
10 0.2
11 0.22
12 0.2
13 0.2
14 0.17
15 0.16
16 0.23
17 0.22
18 0.25
19 0.22
20 0.21
21 0.21
22 0.21
23 0.22
24 0.14
25 0.14
26 0.11
27 0.11
28 0.11
29 0.13
30 0.12
31 0.11
32 0.11
33 0.07
34 0.07
35 0.07
36 0.07
37 0.04
38 0.04
39 0.04
40 0.04
41 0.04
42 0.04
43 0.05
44 0.06
45 0.06
46 0.06
47 0.06
48 0.06
49 0.07
50 0.1
51 0.1
52 0.09
53 0.09
54 0.14
55 0.14
56 0.16
57 0.15
58 0.13
59 0.15
60 0.16
61 0.2
62 0.15
63 0.16
64 0.15
65 0.15
66 0.14
67 0.13
68 0.13
69 0.12
70 0.14
71 0.13
72 0.14
73 0.13
74 0.13
75 0.13
76 0.12
77 0.14
78 0.12
79 0.12
80 0.11
81 0.13
82 0.14
83 0.14
84 0.14
85 0.1
86 0.11
87 0.12
88 0.14
89 0.12
90 0.1
91 0.1
92 0.1
93 0.11
94 0.11
95 0.09
96 0.08
97 0.08
98 0.08
99 0.08
100 0.12
101 0.12
102 0.15
103 0.16
104 0.16
105 0.17
106 0.2
107 0.2
108 0.18
109 0.22
110 0.25
111 0.25
112 0.25
113 0.24
114 0.21
115 0.21
116 0.21
117 0.21
118 0.15
119 0.15
120 0.15
121 0.16
122 0.15
123 0.14
124 0.13
125 0.11
126 0.11
127 0.12
128 0.12
129 0.13
130 0.13
131 0.15
132 0.16
133 0.17
134 0.18
135 0.17
136 0.19
137 0.25
138 0.32
139 0.32
140 0.35
141 0.34
142 0.38
143 0.43
144 0.47
145 0.5
146 0.54
147 0.62
148 0.69
149 0.77
150 0.76
151 0.78
152 0.82
153 0.82
154 0.8
155 0.75
156 0.65
157 0.57
158 0.59
159 0.6
160 0.54
161 0.45
162 0.46
163 0.43
164 0.48
165 0.53
166 0.55
167 0.57
168 0.62
169 0.7