Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B1PBW8

Protein Details
Accession A0A0B1PBW8    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
31-60SMNGQTRRLKPVKEKKKRKSIYRVGNLFRIHydrophilic
NLS Segment(s)
PositionSequence
37-49RRLKPVKEKKKRK
Subcellular Location(s) nucl 20.5, mito_nucl 13, mito 4.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MVISNDERQKTNQNHKMASDTNGKSISASPSMNGQTRRLKPVKEKKKRKSIYRVGNLFRIAFWYFIFTCFYCPSSLNSLTNDSPKACKAYFQVTNFVAPVIQPYLNIYAAPYLEPIWPYYTAIQKRIIKPTLKLGGKYGVPLVEKVFLLIKFNWRKFAQPQVEKCYDTLYQYYRLKLGSYSDIANKTINSYHEKIKTELLPIYSSIILSYYYAIEPQIVKGYILGHEIVTNNIYPCIKWTLNNGESFFVGIIRPKLKLLYGESVEPQLLKISERLGRYRTARKIKFTSNENHRKVSLQSLKLNTNF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.61
3 0.64
4 0.57
5 0.53
6 0.52
7 0.45
8 0.43
9 0.41
10 0.39
11 0.33
12 0.33
13 0.32
14 0.26
15 0.24
16 0.2
17 0.24
18 0.29
19 0.33
20 0.33
21 0.35
22 0.41
23 0.45
24 0.55
25 0.54
26 0.56
27 0.61
28 0.7
29 0.75
30 0.77
31 0.83
32 0.84
33 0.9
34 0.92
35 0.92
36 0.92
37 0.91
38 0.91
39 0.9
40 0.88
41 0.81
42 0.78
43 0.69
44 0.58
45 0.48
46 0.4
47 0.3
48 0.22
49 0.18
50 0.17
51 0.15
52 0.16
53 0.19
54 0.15
55 0.18
56 0.19
57 0.2
58 0.16
59 0.17
60 0.19
61 0.23
62 0.26
63 0.25
64 0.25
65 0.28
66 0.29
67 0.31
68 0.3
69 0.24
70 0.23
71 0.23
72 0.26
73 0.21
74 0.23
75 0.22
76 0.28
77 0.33
78 0.33
79 0.37
80 0.34
81 0.35
82 0.32
83 0.28
84 0.21
85 0.14
86 0.13
87 0.1
88 0.09
89 0.08
90 0.1
91 0.12
92 0.12
93 0.12
94 0.1
95 0.09
96 0.09
97 0.1
98 0.08
99 0.07
100 0.08
101 0.09
102 0.09
103 0.1
104 0.11
105 0.12
106 0.13
107 0.19
108 0.21
109 0.23
110 0.3
111 0.33
112 0.37
113 0.43
114 0.46
115 0.41
116 0.4
117 0.45
118 0.46
119 0.42
120 0.38
121 0.33
122 0.31
123 0.29
124 0.28
125 0.21
126 0.15
127 0.14
128 0.14
129 0.13
130 0.11
131 0.1
132 0.1
133 0.12
134 0.1
135 0.12
136 0.12
137 0.19
138 0.25
139 0.26
140 0.3
141 0.29
142 0.32
143 0.32
144 0.41
145 0.41
146 0.42
147 0.46
148 0.48
149 0.5
150 0.48
151 0.45
152 0.39
153 0.31
154 0.25
155 0.23
156 0.18
157 0.22
158 0.23
159 0.24
160 0.22
161 0.22
162 0.21
163 0.19
164 0.19
165 0.14
166 0.14
167 0.15
168 0.17
169 0.18
170 0.19
171 0.19
172 0.16
173 0.15
174 0.16
175 0.17
176 0.19
177 0.2
178 0.26
179 0.31
180 0.33
181 0.33
182 0.34
183 0.33
184 0.3
185 0.3
186 0.25
187 0.2
188 0.18
189 0.19
190 0.15
191 0.14
192 0.11
193 0.09
194 0.08
195 0.07
196 0.08
197 0.06
198 0.06
199 0.07
200 0.07
201 0.08
202 0.08
203 0.09
204 0.11
205 0.11
206 0.11
207 0.11
208 0.12
209 0.12
210 0.13
211 0.12
212 0.09
213 0.1
214 0.1
215 0.11
216 0.11
217 0.11
218 0.1
219 0.12
220 0.12
221 0.1
222 0.13
223 0.19
224 0.18
225 0.19
226 0.25
227 0.32
228 0.36
229 0.4
230 0.38
231 0.33
232 0.32
233 0.31
234 0.25
235 0.16
236 0.12
237 0.12
238 0.15
239 0.16
240 0.17
241 0.17
242 0.18
243 0.19
244 0.23
245 0.25
246 0.27
247 0.28
248 0.29
249 0.3
250 0.3
251 0.29
252 0.25
253 0.2
254 0.16
255 0.14
256 0.13
257 0.13
258 0.16
259 0.21
260 0.24
261 0.29
262 0.28
263 0.34
264 0.4
265 0.48
266 0.54
267 0.6
268 0.63
269 0.67
270 0.72
271 0.74
272 0.74
273 0.72
274 0.72
275 0.72
276 0.77
277 0.74
278 0.71
279 0.63
280 0.59
281 0.54
282 0.55
283 0.53
284 0.49
285 0.52
286 0.54