Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B1PFY3

Protein Details
Accession A0A0B1PFY3    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
13-43LKKSFLLKLKYSRNHKKEKKAEKSCCPIKKAHydrophilic
NLS Segment(s)
PositionSequence
25-32RNHKKEKK
Subcellular Location(s) mito 14.5, mito_nucl 13.333, nucl 11, cyto_nucl 6.833
Family & Domain DBs
Amino Acid Sequences MARFTSNSKSSDLKKSFLLKLKYSRNHKKEKKAEKSCCPIKKATGTLRNILCCPDSEEPADEVADTSYWPVRVAYEPPNQNLFLGSQGLSLYQMGGTCFQPTLEPAPTPRHKTRSGRVRIHDNKVVVINNYF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.48
3 0.52
4 0.54
5 0.55
6 0.51
7 0.57
8 0.64
9 0.67
10 0.72
11 0.75
12 0.76
13 0.81
14 0.84
15 0.86
16 0.86
17 0.89
18 0.89
19 0.89
20 0.89
21 0.87
22 0.88
23 0.87
24 0.83
25 0.76
26 0.67
27 0.62
28 0.59
29 0.57
30 0.56
31 0.55
32 0.51
33 0.53
34 0.53
35 0.49
36 0.43
37 0.37
38 0.28
39 0.2
40 0.23
41 0.18
42 0.17
43 0.16
44 0.17
45 0.17
46 0.17
47 0.16
48 0.11
49 0.09
50 0.07
51 0.06
52 0.05
53 0.05
54 0.05
55 0.05
56 0.05
57 0.05
58 0.06
59 0.08
60 0.11
61 0.16
62 0.22
63 0.25
64 0.26
65 0.29
66 0.28
67 0.27
68 0.24
69 0.18
70 0.13
71 0.12
72 0.1
73 0.08
74 0.08
75 0.08
76 0.08
77 0.07
78 0.06
79 0.05
80 0.06
81 0.06
82 0.08
83 0.08
84 0.08
85 0.08
86 0.09
87 0.09
88 0.1
89 0.14
90 0.14
91 0.15
92 0.17
93 0.27
94 0.33
95 0.41
96 0.46
97 0.48
98 0.55
99 0.62
100 0.69
101 0.7
102 0.74
103 0.75
104 0.74
105 0.79
106 0.79
107 0.8
108 0.76
109 0.67
110 0.6
111 0.55
112 0.52