Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0B1PD32

Protein Details
Accession A0A0B1PD32    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
194-241EKSVASKASKKQKKRDLVLESKVEVVKLHSKAKIKKRDTKKDDFFDDIHydrophilic
NLS Segment(s)
PositionSequence
198-209ASKASKKQKKRD
220-231KLHSKAKIKKRD
Subcellular Location(s) nucl 16.5, cyto_nucl 12, cyto 6.5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR047205  RMP1  
IPR047204  RMP1_RBD  
Gene Ontology GO:0000172  C:ribonuclease MRP complex  
GO:0042134  F:rRNA primary transcript binding  
CDD cd22573  RMP1_RBD  
Amino Acid Sequences MEGENLLSSIQKLQNISQLLHLAHHRNKNQHRVSRWYKYFGQLRRQISKLILELDTFATAIKVACDVTTTNTSESVTTNKYVLSAKKKIEQRNKFLHKILLPKCYLAFGNLIADNQYAVLGIMLMGLLASVNNILSTLPISNQEEKISDSIEHEKTIDASVIKDNRLDDLGEIVSRQDFNAQFPACIKNGKMGEKSVASKASKKQKKRDLVLESKVEVVKLHSKAKIKKRDTKKDDFFDDIFKNLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.3
3 0.3
4 0.27
5 0.29
6 0.26
7 0.27
8 0.3
9 0.32
10 0.37
11 0.45
12 0.48
13 0.54
14 0.62
15 0.7
16 0.75
17 0.75
18 0.74
19 0.75
20 0.78
21 0.79
22 0.75
23 0.71
24 0.65
25 0.65
26 0.67
27 0.64
28 0.65
29 0.62
30 0.65
31 0.65
32 0.63
33 0.57
34 0.51
35 0.48
36 0.4
37 0.35
38 0.28
39 0.22
40 0.22
41 0.2
42 0.18
43 0.13
44 0.11
45 0.08
46 0.07
47 0.07
48 0.06
49 0.05
50 0.05
51 0.05
52 0.06
53 0.07
54 0.1
55 0.14
56 0.15
57 0.15
58 0.16
59 0.16
60 0.15
61 0.16
62 0.16
63 0.14
64 0.14
65 0.14
66 0.13
67 0.14
68 0.17
69 0.22
70 0.26
71 0.3
72 0.32
73 0.38
74 0.46
75 0.53
76 0.61
77 0.63
78 0.64
79 0.69
80 0.73
81 0.7
82 0.65
83 0.61
84 0.53
85 0.55
86 0.51
87 0.46
88 0.4
89 0.36
90 0.34
91 0.31
92 0.27
93 0.19
94 0.15
95 0.09
96 0.1
97 0.1
98 0.1
99 0.09
100 0.08
101 0.07
102 0.06
103 0.06
104 0.04
105 0.03
106 0.03
107 0.02
108 0.02
109 0.02
110 0.02
111 0.02
112 0.02
113 0.02
114 0.02
115 0.02
116 0.02
117 0.02
118 0.02
119 0.02
120 0.02
121 0.02
122 0.03
123 0.03
124 0.04
125 0.04
126 0.07
127 0.1
128 0.12
129 0.13
130 0.14
131 0.14
132 0.15
133 0.15
134 0.14
135 0.11
136 0.12
137 0.17
138 0.17
139 0.17
140 0.16
141 0.15
142 0.15
143 0.15
144 0.14
145 0.08
146 0.09
147 0.14
148 0.16
149 0.16
150 0.17
151 0.17
152 0.16
153 0.17
154 0.16
155 0.11
156 0.11
157 0.11
158 0.09
159 0.09
160 0.08
161 0.08
162 0.08
163 0.08
164 0.11
165 0.11
166 0.13
167 0.2
168 0.2
169 0.2
170 0.22
171 0.25
172 0.21
173 0.22
174 0.21
175 0.21
176 0.25
177 0.3
178 0.3
179 0.29
180 0.32
181 0.33
182 0.36
183 0.32
184 0.34
185 0.32
186 0.35
187 0.41
188 0.49
189 0.54
190 0.61
191 0.67
192 0.71
193 0.79
194 0.81
195 0.83
196 0.81
197 0.82
198 0.8
199 0.75
200 0.66
201 0.6
202 0.53
203 0.43
204 0.33
205 0.28
206 0.29
207 0.28
208 0.33
209 0.34
210 0.42
211 0.52
212 0.61
213 0.68
214 0.69
215 0.75
216 0.8
217 0.86
218 0.87
219 0.89
220 0.88
221 0.86
222 0.83
223 0.79
224 0.69
225 0.66
226 0.59