Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B1PB88

Protein Details
Accession A0A0B1PB88    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
226-245LSENRLRKRVKKDEETLEIDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR015886  DNA_glyclase/AP_lyase_DNA-bd  
IPR010979  Ribosomal_S13-like_H2TH  
Gene Ontology GO:0003684  F:damaged DNA binding  
GO:0003906  F:DNA-(apurinic or apyrimidinic site) endonuclease activity  
GO:0016799  F:hydrolase activity, hydrolyzing N-glycosyl compounds  
GO:0008270  F:zinc ion binding  
GO:0006284  P:base-excision repair  
Pfam View protein in Pfam  
PF06831  H2TH  
Amino Acid Sequences MEATNPDARNEMGIENGTSMAEVAFTDPRRFGRVRLLNCDKEDIRKISPLKENGPDPIIDKSILSLEWLQSKLNCKHVHIKSFLLDQANISGIGNWVGDEILYNAKIHPEQYSDTLSVEQIKVLHHCIMYVCETAVGVLADSEKFPSDWLFNYRWGKAMLTKTAKKRKNSEDSKEPTHEDPKCLPNGTKISFVTVGGRTSCFVPSLQQKKLQDKLSNDYDEENENLSENRLRKRVKKDEETLEIDKNKRTLRSVKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.14
4 0.12
5 0.1
6 0.1
7 0.07
8 0.06
9 0.05
10 0.07
11 0.12
12 0.14
13 0.17
14 0.19
15 0.21
16 0.27
17 0.28
18 0.28
19 0.33
20 0.4
21 0.44
22 0.51
23 0.58
24 0.58
25 0.59
26 0.63
27 0.54
28 0.52
29 0.52
30 0.47
31 0.41
32 0.42
33 0.43
34 0.44
35 0.5
36 0.49
37 0.47
38 0.48
39 0.47
40 0.43
41 0.42
42 0.35
43 0.29
44 0.27
45 0.23
46 0.18
47 0.16
48 0.14
49 0.13
50 0.12
51 0.12
52 0.11
53 0.11
54 0.15
55 0.15
56 0.15
57 0.17
58 0.25
59 0.26
60 0.33
61 0.33
62 0.33
63 0.42
64 0.47
65 0.51
66 0.46
67 0.45
68 0.39
69 0.4
70 0.39
71 0.3
72 0.25
73 0.19
74 0.17
75 0.16
76 0.13
77 0.11
78 0.08
79 0.07
80 0.07
81 0.06
82 0.05
83 0.05
84 0.04
85 0.04
86 0.04
87 0.05
88 0.06
89 0.06
90 0.06
91 0.06
92 0.08
93 0.08
94 0.09
95 0.09
96 0.09
97 0.1
98 0.13
99 0.15
100 0.14
101 0.14
102 0.14
103 0.13
104 0.13
105 0.12
106 0.1
107 0.08
108 0.08
109 0.09
110 0.1
111 0.11
112 0.09
113 0.1
114 0.09
115 0.1
116 0.11
117 0.1
118 0.08
119 0.07
120 0.07
121 0.07
122 0.07
123 0.05
124 0.03
125 0.03
126 0.03
127 0.04
128 0.04
129 0.05
130 0.04
131 0.05
132 0.05
133 0.06
134 0.07
135 0.08
136 0.12
137 0.14
138 0.2
139 0.23
140 0.23
141 0.24
142 0.24
143 0.23
144 0.25
145 0.26
146 0.27
147 0.32
148 0.37
149 0.45
150 0.54
151 0.6
152 0.61
153 0.66
154 0.68
155 0.72
156 0.75
157 0.73
158 0.73
159 0.74
160 0.74
161 0.69
162 0.62
163 0.55
164 0.55
165 0.48
166 0.43
167 0.41
168 0.39
169 0.39
170 0.39
171 0.35
172 0.34
173 0.39
174 0.36
175 0.37
176 0.32
177 0.32
178 0.3
179 0.3
180 0.27
181 0.22
182 0.21
183 0.17
184 0.18
185 0.15
186 0.16
187 0.16
188 0.13
189 0.12
190 0.15
191 0.25
192 0.31
193 0.34
194 0.41
195 0.46
196 0.53
197 0.6
198 0.62
199 0.59
200 0.57
201 0.6
202 0.61
203 0.57
204 0.5
205 0.45
206 0.39
207 0.35
208 0.31
209 0.26
210 0.18
211 0.16
212 0.16
213 0.16
214 0.2
215 0.23
216 0.28
217 0.34
218 0.41
219 0.48
220 0.59
221 0.67
222 0.72
223 0.77
224 0.78
225 0.8
226 0.81
227 0.79
228 0.73
229 0.7
230 0.66
231 0.6
232 0.55
233 0.52
234 0.5
235 0.46
236 0.49