Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B1P2W9

Protein Details
Accession A0A0B1P2W9    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
16-42LWKIPWRLSKFQKARQRKRLRAVDNVVHydrophilic
75-110KDKYTMFDRKEKKYRKCLRKLPKWTRVSQRINPPGYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22.5, cyto_mito 12.5, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MLGAFNRTNSLFGGLLWKIPWRLSKFQKARQRKRLRAVDNVVSVVDKALAKQGTTLKSLEIWKKVMPTEQEMLPKDKYTMFDRKEKKYRKCLRKLPKWTRVSQRINPPGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.17
4 0.18
5 0.16
6 0.19
7 0.26
8 0.27
9 0.35
10 0.42
11 0.52
12 0.58
13 0.66
14 0.74
15 0.78
16 0.83
17 0.85
18 0.89
19 0.87
20 0.88
21 0.89
22 0.83
23 0.81
24 0.76
25 0.71
26 0.61
27 0.53
28 0.43
29 0.33
30 0.27
31 0.18
32 0.14
33 0.08
34 0.06
35 0.09
36 0.09
37 0.09
38 0.12
39 0.16
40 0.16
41 0.18
42 0.18
43 0.14
44 0.16
45 0.21
46 0.22
47 0.2
48 0.2
49 0.19
50 0.21
51 0.22
52 0.23
53 0.21
54 0.21
55 0.21
56 0.23
57 0.27
58 0.27
59 0.3
60 0.28
61 0.27
62 0.24
63 0.23
64 0.24
65 0.24
66 0.31
67 0.31
68 0.4
69 0.46
70 0.54
71 0.63
72 0.7
73 0.73
74 0.75
75 0.82
76 0.84
77 0.88
78 0.89
79 0.9
80 0.91
81 0.93
82 0.93
83 0.92
84 0.89
85 0.87
86 0.87
87 0.87
88 0.85
89 0.82
90 0.82