Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B1P8P7

Protein Details
Accession A0A0B1P8P7    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
84-110ESYIIFGKRTRKERKRPRTWNSAKELQHydrophilic
NLS Segment(s)
PositionSequence
91-101KRTRKERKRPR
Subcellular Location(s) nucl 25.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MICPQPSMIFDGEDIPIRNNKPNSQTSDDENIDNETKVKLTCEEDLISSFENKKVVLQEDHYSVQKQILDIPPKLRVNPSDIDESYIIFGKRTRKERKRPRTWNSAKELQRLHQSELPPPPSSWRELKNHPYSQALRNAMMVEYNALIAKDVIKKVKHTNNMKPIHLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.22
4 0.24
5 0.31
6 0.33
7 0.37
8 0.41
9 0.47
10 0.52
11 0.52
12 0.52
13 0.5
14 0.54
15 0.5
16 0.44
17 0.38
18 0.34
19 0.29
20 0.27
21 0.22
22 0.14
23 0.14
24 0.14
25 0.14
26 0.13
27 0.15
28 0.16
29 0.18
30 0.18
31 0.17
32 0.18
33 0.19
34 0.17
35 0.16
36 0.16
37 0.15
38 0.15
39 0.14
40 0.14
41 0.15
42 0.18
43 0.18
44 0.2
45 0.21
46 0.23
47 0.25
48 0.25
49 0.23
50 0.2
51 0.2
52 0.17
53 0.15
54 0.16
55 0.2
56 0.23
57 0.23
58 0.25
59 0.29
60 0.3
61 0.3
62 0.28
63 0.23
64 0.23
65 0.24
66 0.24
67 0.22
68 0.21
69 0.23
70 0.21
71 0.2
72 0.16
73 0.16
74 0.13
75 0.09
76 0.12
77 0.17
78 0.23
79 0.32
80 0.42
81 0.5
82 0.62
83 0.73
84 0.81
85 0.85
86 0.9
87 0.88
88 0.89
89 0.88
90 0.85
91 0.81
92 0.79
93 0.71
94 0.67
95 0.62
96 0.53
97 0.54
98 0.48
99 0.44
100 0.39
101 0.37
102 0.37
103 0.41
104 0.41
105 0.34
106 0.32
107 0.33
108 0.31
109 0.34
110 0.34
111 0.34
112 0.36
113 0.42
114 0.52
115 0.56
116 0.58
117 0.56
118 0.58
119 0.55
120 0.55
121 0.55
122 0.48
123 0.4
124 0.37
125 0.35
126 0.28
127 0.25
128 0.19
129 0.12
130 0.09
131 0.09
132 0.09
133 0.08
134 0.08
135 0.08
136 0.11
137 0.16
138 0.2
139 0.25
140 0.27
141 0.32
142 0.42
143 0.51
144 0.57
145 0.61
146 0.67
147 0.71
148 0.76