Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B1PB03

Protein Details
Accession A0A0B1PB03    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
220-250LNKSWVLTAKQERRCRKRVNRQTKNSYKESRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9.5cyto_mito 9.5, cyto 8.5, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR018856  Stn1_N  
Pfam View protein in Pfam  
PF10451  Stn1  
Amino Acid Sequences MTPTPESPRQDIYPVYCHILSPTIGRWCPLWATDINALKDVGIFCDGRKLLHYGNHPIKWVRVTGVIVAIDCGGNGSNFKRIYTLDDSSGSCIECSAPAPNAALPASKNTPLIQNQSEELKKKNLGDKVINPTRSSGQGQRGKQNKATSQSELKSEGPSVLNPIVPWDKVHVGSVVKIKGKVDVWWDHKRVEIVKLEILRCTDIEVRCWNEVIRFREDILNKSWVLTAKQERRCRKRVNRQTKNSYKESR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.38
3 0.33
4 0.3
5 0.28
6 0.27
7 0.23
8 0.21
9 0.24
10 0.27
11 0.27
12 0.27
13 0.27
14 0.26
15 0.27
16 0.24
17 0.22
18 0.16
19 0.2
20 0.26
21 0.32
22 0.31
23 0.3
24 0.29
25 0.25
26 0.27
27 0.22
28 0.16
29 0.13
30 0.12
31 0.11
32 0.18
33 0.19
34 0.17
35 0.19
36 0.21
37 0.21
38 0.26
39 0.31
40 0.33
41 0.41
42 0.43
43 0.44
44 0.41
45 0.41
46 0.37
47 0.34
48 0.26
49 0.2
50 0.19
51 0.17
52 0.19
53 0.16
54 0.14
55 0.13
56 0.12
57 0.09
58 0.08
59 0.07
60 0.05
61 0.05
62 0.06
63 0.07
64 0.13
65 0.13
66 0.14
67 0.15
68 0.15
69 0.21
70 0.25
71 0.26
72 0.22
73 0.24
74 0.24
75 0.24
76 0.24
77 0.19
78 0.13
79 0.11
80 0.09
81 0.07
82 0.08
83 0.08
84 0.08
85 0.08
86 0.09
87 0.09
88 0.1
89 0.1
90 0.09
91 0.08
92 0.11
93 0.13
94 0.13
95 0.14
96 0.13
97 0.17
98 0.19
99 0.23
100 0.21
101 0.2
102 0.19
103 0.23
104 0.25
105 0.23
106 0.23
107 0.21
108 0.22
109 0.24
110 0.28
111 0.27
112 0.28
113 0.3
114 0.33
115 0.39
116 0.43
117 0.42
118 0.36
119 0.35
120 0.32
121 0.31
122 0.29
123 0.24
124 0.28
125 0.33
126 0.36
127 0.42
128 0.47
129 0.48
130 0.5
131 0.51
132 0.46
133 0.45
134 0.46
135 0.42
136 0.41
137 0.39
138 0.37
139 0.35
140 0.32
141 0.26
142 0.23
143 0.21
144 0.16
145 0.15
146 0.16
147 0.14
148 0.13
149 0.12
150 0.15
151 0.15
152 0.14
153 0.15
154 0.14
155 0.16
156 0.16
157 0.17
158 0.16
159 0.14
160 0.17
161 0.21
162 0.22
163 0.22
164 0.23
165 0.22
166 0.24
167 0.24
168 0.23
169 0.25
170 0.29
171 0.34
172 0.41
173 0.43
174 0.4
175 0.41
176 0.42
177 0.38
178 0.36
179 0.33
180 0.27
181 0.3
182 0.33
183 0.32
184 0.31
185 0.3
186 0.26
187 0.21
188 0.22
189 0.23
190 0.2
191 0.23
192 0.27
193 0.3
194 0.29
195 0.3
196 0.28
197 0.28
198 0.35
199 0.35
200 0.35
201 0.32
202 0.33
203 0.39
204 0.41
205 0.38
206 0.35
207 0.35
208 0.3
209 0.29
210 0.3
211 0.26
212 0.26
213 0.31
214 0.37
215 0.42
216 0.52
217 0.61
218 0.69
219 0.75
220 0.83
221 0.85
222 0.86
223 0.88
224 0.9
225 0.92
226 0.92
227 0.94
228 0.96
229 0.95
230 0.91