Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B1P2Y1

Protein Details
Accession A0A0B1P2Y1    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MSEYWKSTPKYWCKHCKTFVRDTKLEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 25, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR003604  Matrin/U1-like-C_Znf_C2H2  
IPR013085  U1-CZ_Znf_C2H2  
IPR040023  WBP4  
IPR036236  Znf_C2H2_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
GO:0000398  P:mRNA splicing, via spliceosome  
Pfam View protein in Pfam  
PF06220  zf-U1  
Amino Acid Sequences MSEYWKSTPKYWCKHCKTFVRDTKLETANHNASPKHQGNLKRFLRDLQRNHDKDEKDKERAKSEVARLNDLVPGKRSQIKSSPAIGDKPRSNFSRNKAPSTSEVSELQRKQNLAQLAEMGISIPSEFRADMAMPGEWQTISEKVIDPIKVEIKPEITSTGRRKRKLDDGETEEEEERLISNKRKSNWKLPYEDDDNELNALLMTTQFKKKIIKSESPTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.86
3 0.86
4 0.84
5 0.85
6 0.84
7 0.83
8 0.76
9 0.71
10 0.71
11 0.66
12 0.6
13 0.52
14 0.5
15 0.46
16 0.46
17 0.45
18 0.37
19 0.34
20 0.42
21 0.4
22 0.36
23 0.37
24 0.42
25 0.45
26 0.55
27 0.57
28 0.53
29 0.52
30 0.53
31 0.58
32 0.59
33 0.59
34 0.59
35 0.64
36 0.61
37 0.65
38 0.67
39 0.59
40 0.57
41 0.61
42 0.57
43 0.55
44 0.6
45 0.59
46 0.57
47 0.56
48 0.54
49 0.5
50 0.49
51 0.48
52 0.43
53 0.42
54 0.37
55 0.36
56 0.35
57 0.3
58 0.24
59 0.2
60 0.19
61 0.19
62 0.24
63 0.25
64 0.26
65 0.3
66 0.34
67 0.35
68 0.37
69 0.39
70 0.34
71 0.37
72 0.36
73 0.36
74 0.35
75 0.34
76 0.36
77 0.34
78 0.37
79 0.38
80 0.4
81 0.45
82 0.44
83 0.45
84 0.42
85 0.42
86 0.41
87 0.43
88 0.39
89 0.3
90 0.3
91 0.28
92 0.33
93 0.32
94 0.31
95 0.26
96 0.25
97 0.24
98 0.25
99 0.24
100 0.18
101 0.17
102 0.15
103 0.12
104 0.12
105 0.11
106 0.07
107 0.05
108 0.04
109 0.04
110 0.03
111 0.04
112 0.04
113 0.04
114 0.04
115 0.05
116 0.06
117 0.06
118 0.08
119 0.07
120 0.07
121 0.08
122 0.08
123 0.07
124 0.07
125 0.08
126 0.08
127 0.08
128 0.09
129 0.09
130 0.11
131 0.14
132 0.14
133 0.13
134 0.16
135 0.19
136 0.19
137 0.19
138 0.19
139 0.18
140 0.19
141 0.19
142 0.2
143 0.18
144 0.25
145 0.33
146 0.42
147 0.48
148 0.52
149 0.55
150 0.57
151 0.64
152 0.66
153 0.65
154 0.63
155 0.63
156 0.63
157 0.62
158 0.59
159 0.49
160 0.39
161 0.32
162 0.23
163 0.16
164 0.13
165 0.16
166 0.2
167 0.27
168 0.33
169 0.38
170 0.49
171 0.55
172 0.63
173 0.68
174 0.69
175 0.68
176 0.68
177 0.7
178 0.66
179 0.61
180 0.54
181 0.45
182 0.39
183 0.32
184 0.27
185 0.19
186 0.12
187 0.11
188 0.07
189 0.07
190 0.1
191 0.14
192 0.2
193 0.22
194 0.26
195 0.33
196 0.38
197 0.47
198 0.51
199 0.57