Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0B1P555

Protein Details
Accession A0A0B1P555    Localization Confidence High Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
201-226AIKTSGKKAHYNKLKSKRIKGGILNSHydrophilic
NLS Segment(s)
PositionSequence
207-220KKAHYNKLKSKRIK
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR039883  Fcf2/DNTTIP2  
IPR014810  Fcf2_C  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF08698  Fcf2  
Amino Acid Sequences MADEDLSEPQLKQLLKDAEERLRKNEKIPQISENDLVKNLQQNISSIAAATKIEPYVIGLHNIPNVETAHLIPKKDRIKSDGVRIVVDPIAMKKKASEEKKATAGTDWYNLPRTRLTPELKRDLQLLRMRDVLDPKRHYKKDSSRTNVPEFSQVGTIIEGPTEYFSGRLSNKQRKKTLVEETLENENITGRYKKKYNEIQAIKTSGKKAHYNKLKSKRIKGGILNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.29
3 0.35
4 0.39
5 0.43
6 0.51
7 0.53
8 0.52
9 0.56
10 0.55
11 0.54
12 0.57
13 0.58
14 0.57
15 0.58
16 0.56
17 0.52
18 0.54
19 0.54
20 0.49
21 0.41
22 0.34
23 0.31
24 0.27
25 0.28
26 0.27
27 0.24
28 0.22
29 0.21
30 0.23
31 0.24
32 0.22
33 0.17
34 0.14
35 0.12
36 0.12
37 0.12
38 0.1
39 0.08
40 0.08
41 0.08
42 0.09
43 0.12
44 0.12
45 0.13
46 0.12
47 0.14
48 0.15
49 0.15
50 0.14
51 0.12
52 0.12
53 0.11
54 0.11
55 0.11
56 0.17
57 0.19
58 0.2
59 0.19
60 0.27
61 0.33
62 0.36
63 0.38
64 0.34
65 0.4
66 0.43
67 0.51
68 0.48
69 0.43
70 0.39
71 0.37
72 0.35
73 0.26
74 0.23
75 0.14
76 0.11
77 0.15
78 0.14
79 0.14
80 0.13
81 0.19
82 0.27
83 0.31
84 0.37
85 0.38
86 0.41
87 0.46
88 0.46
89 0.4
90 0.33
91 0.31
92 0.23
93 0.2
94 0.17
95 0.14
96 0.18
97 0.17
98 0.18
99 0.17
100 0.17
101 0.18
102 0.23
103 0.26
104 0.28
105 0.33
106 0.39
107 0.39
108 0.39
109 0.39
110 0.33
111 0.36
112 0.34
113 0.3
114 0.24
115 0.25
116 0.25
117 0.25
118 0.3
119 0.29
120 0.32
121 0.35
122 0.41
123 0.49
124 0.5
125 0.51
126 0.54
127 0.59
128 0.61
129 0.67
130 0.67
131 0.66
132 0.7
133 0.73
134 0.66
135 0.56
136 0.51
137 0.41
138 0.35
139 0.27
140 0.21
141 0.16
142 0.14
143 0.13
144 0.09
145 0.07
146 0.06
147 0.06
148 0.06
149 0.06
150 0.06
151 0.06
152 0.06
153 0.11
154 0.12
155 0.2
156 0.29
157 0.4
158 0.48
159 0.57
160 0.62
161 0.64
162 0.69
163 0.68
164 0.69
165 0.66
166 0.61
167 0.55
168 0.52
169 0.52
170 0.46
171 0.38
172 0.28
173 0.22
174 0.19
175 0.2
176 0.22
177 0.19
178 0.26
179 0.31
180 0.35
181 0.44
182 0.53
183 0.59
184 0.65
185 0.69
186 0.69
187 0.7
188 0.71
189 0.64
190 0.59
191 0.54
192 0.48
193 0.46
194 0.48
195 0.49
196 0.55
197 0.61
198 0.67
199 0.73
200 0.79
201 0.84
202 0.84
203 0.87
204 0.87
205 0.85
206 0.83