Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B1P4H3

Protein Details
Accession A0A0B1P4H3    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-34MPKEKSTTRKNSKPRSEKKKKKKDPNAPKRGLTABasic
NLS Segment(s)
PositionSequence
7-30TTRKNSKPRSEKKKKKKDPNAPKR
Subcellular Location(s) nucl 24, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKEKSTTRKNSKPRSEKKKKKKDPNAPKRGLTAYMFFAIEQREIVRDENPGITFGQVGKLLGQRWKELDEEQRTPYEVKAAEDKKRYTDEKANYNPDAEEEEEESC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.92
3 0.93
4 0.94
5 0.95
6 0.96
7 0.95
8 0.96
9 0.96
10 0.96
11 0.96
12 0.96
13 0.96
14 0.9
15 0.82
16 0.75
17 0.66
18 0.58
19 0.48
20 0.39
21 0.3
22 0.25
23 0.22
24 0.18
25 0.17
26 0.14
27 0.12
28 0.1
29 0.08
30 0.08
31 0.09
32 0.11
33 0.1
34 0.1
35 0.11
36 0.12
37 0.12
38 0.11
39 0.1
40 0.09
41 0.09
42 0.08
43 0.08
44 0.07
45 0.07
46 0.07
47 0.09
48 0.1
49 0.14
50 0.15
51 0.15
52 0.16
53 0.18
54 0.18
55 0.19
56 0.26
57 0.29
58 0.31
59 0.32
60 0.31
61 0.32
62 0.31
63 0.28
64 0.24
65 0.19
66 0.18
67 0.25
68 0.29
69 0.35
70 0.4
71 0.42
72 0.42
73 0.47
74 0.48
75 0.46
76 0.5
77 0.49
78 0.53
79 0.6
80 0.62
81 0.57
82 0.55
83 0.49
84 0.41
85 0.38
86 0.3
87 0.24