Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0B1NV62

Protein Details
Accession A0A0B1NV62    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
20-43ASSARIKRNKKSSQTKFKVRCQKYHydrophilic
NLS Segment(s)
PositionSequence
26-29KRNK
Subcellular Location(s) nucl 21.5, cyto_nucl 13, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPRETSDIKQFIEICRRKDASSARIKRNKKSSQTKFKVRCQKYLYTLVLKDSEKVEKLKQSLPPNLVIADTPKKNAKGKRTAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.45
3 0.46
4 0.42
5 0.47
6 0.48
7 0.47
8 0.53
9 0.58
10 0.6
11 0.67
12 0.71
13 0.73
14 0.76
15 0.76
16 0.75
17 0.77
18 0.78
19 0.8
20 0.84
21 0.86
22 0.83
23 0.83
24 0.84
25 0.76
26 0.73
27 0.67
28 0.63
29 0.58
30 0.57
31 0.51
32 0.44
33 0.41
34 0.34
35 0.33
36 0.29
37 0.25
38 0.2
39 0.2
40 0.19
41 0.21
42 0.23
43 0.24
44 0.27
45 0.31
46 0.36
47 0.4
48 0.44
49 0.44
50 0.43
51 0.4
52 0.37
53 0.32
54 0.26
55 0.24
56 0.26
57 0.25
58 0.27
59 0.31
60 0.36
61 0.43
62 0.5
63 0.54