Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q5K7J3

Protein Details
Accession Q5K7J3    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
3-46AHIPIVKKRTKHFKRHQSDRYHGVKESWRKPKGIDNRVRRRFKGBasic
NLS Segment(s)
PositionSequence
9-46KKRTKHFKRHQSDRYHGVKESWRKPKGIDNRVRRRFKG
Subcellular Location(s) nucl 13, mito 8, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MPAHIPIVKKRTKHFKRHQSDRYHGVKESWRKPKGIDNRVRRRFKGQIPMPKIGYGSNQKTRHLLPSGHKELLVHNLSELELLLMHSGKYAASIAHGVSSKKRVEIIARAKVLGVKVTNPAAKLRTEEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.79
3 0.85
4 0.91
5 0.91
6 0.89
7 0.87
8 0.85
9 0.81
10 0.74
11 0.64
12 0.57
13 0.56
14 0.56
15 0.58
16 0.59
17 0.55
18 0.52
19 0.53
20 0.58
21 0.61
22 0.62
23 0.62
24 0.63
25 0.71
26 0.8
27 0.84
28 0.77
29 0.74
30 0.71
31 0.68
32 0.67
33 0.64
34 0.64
35 0.64
36 0.65
37 0.59
38 0.52
39 0.46
40 0.36
41 0.33
42 0.3
43 0.3
44 0.34
45 0.35
46 0.35
47 0.37
48 0.38
49 0.37
50 0.32
51 0.3
52 0.26
53 0.33
54 0.37
55 0.35
56 0.34
57 0.3
58 0.28
59 0.32
60 0.27
61 0.18
62 0.13
63 0.13
64 0.13
65 0.13
66 0.12
67 0.05
68 0.04
69 0.04
70 0.04
71 0.04
72 0.04
73 0.04
74 0.05
75 0.04
76 0.05
77 0.05
78 0.05
79 0.06
80 0.07
81 0.07
82 0.09
83 0.11
84 0.12
85 0.15
86 0.2
87 0.21
88 0.21
89 0.22
90 0.22
91 0.25
92 0.33
93 0.39
94 0.42
95 0.43
96 0.42
97 0.41
98 0.41
99 0.37
100 0.32
101 0.24
102 0.17
103 0.2
104 0.25
105 0.27
106 0.26
107 0.29
108 0.27
109 0.27