Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B1PGE2

Protein Details
Accession A0A0B1PGE2    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
83-112IDATKAKRKASARKKSKRKYQKLNEEMSKGHydrophilic
NLS Segment(s)
PositionSequence
86-101TKAKRKASARKKSKRK
Subcellular Location(s) nucl 18.5, cyto_nucl 12.333, mito_nucl 12.166, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000352  Pep_chain_release_fac_I  
IPR045853  Pep_chain_release_fac_I_sf  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0016787  F:hydrolase activity  
GO:0003747  F:translation release factor activity  
Pfam View protein in Pfam  
PF00472  RF-1  
Amino Acid Sequences MPDRPGPVDEKEFSEAFLKGSGPGGQKINKTSSAVQLIHKPTGIVVKVQETRSREQNRKIAREKLALKIEKLQKGDESRLAIIDATKAKRKASARKKSKRKYQKLNEEMSKGEQGESPEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.25
3 0.2
4 0.19
5 0.15
6 0.12
7 0.14
8 0.16
9 0.16
10 0.19
11 0.22
12 0.25
13 0.27
14 0.3
15 0.32
16 0.3
17 0.31
18 0.3
19 0.31
20 0.33
21 0.32
22 0.3
23 0.34
24 0.34
25 0.32
26 0.3
27 0.25
28 0.19
29 0.22
30 0.2
31 0.15
32 0.12
33 0.17
34 0.21
35 0.22
36 0.26
37 0.25
38 0.27
39 0.35
40 0.42
41 0.42
42 0.44
43 0.5
44 0.53
45 0.58
46 0.6
47 0.57
48 0.53
49 0.55
50 0.51
51 0.5
52 0.51
53 0.44
54 0.4
55 0.41
56 0.44
57 0.42
58 0.4
59 0.35
60 0.31
61 0.34
62 0.35
63 0.31
64 0.27
65 0.23
66 0.22
67 0.21
68 0.17
69 0.14
70 0.14
71 0.16
72 0.17
73 0.23
74 0.24
75 0.25
76 0.31
77 0.38
78 0.46
79 0.52
80 0.6
81 0.65
82 0.74
83 0.85
84 0.88
85 0.93
86 0.93
87 0.93
88 0.93
89 0.93
90 0.94
91 0.91
92 0.91
93 0.87
94 0.79
95 0.71
96 0.64
97 0.58
98 0.47
99 0.39
100 0.31