Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B1PD24

Protein Details
Accession A0A0B1PD24    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
65-87LICLAIRKRRSRRRQTSLYTPAVHydrophilic
NLS Segment(s)
PositionSequence
72-77KRRSRR
Subcellular Location(s) plas 9, mito 8, nucl 4, cyto 2, extr 2, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR020999  Chitin_synth_reg_RCR  
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAHFSAEPLNTARSALSRRAYGYCVRYGRYGYYSTCDRSFWSRFGRWILAGIMVFLGVTVLITALICLAIRKRRSRRRQTSLYTPAVGTTQQGYFNGSQTYAPPHNAPPKYGGPQPYGGVTQPSDAHVQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.24
3 0.25
4 0.25
5 0.28
6 0.3
7 0.32
8 0.34
9 0.34
10 0.36
11 0.35
12 0.35
13 0.34
14 0.34
15 0.34
16 0.31
17 0.29
18 0.23
19 0.25
20 0.26
21 0.28
22 0.27
23 0.25
24 0.24
25 0.27
26 0.29
27 0.29
28 0.32
29 0.31
30 0.32
31 0.35
32 0.35
33 0.29
34 0.27
35 0.23
36 0.18
37 0.15
38 0.13
39 0.09
40 0.07
41 0.06
42 0.04
43 0.04
44 0.02
45 0.02
46 0.02
47 0.02
48 0.02
49 0.02
50 0.02
51 0.02
52 0.02
53 0.02
54 0.03
55 0.05
56 0.11
57 0.16
58 0.25
59 0.35
60 0.46
61 0.57
62 0.68
63 0.76
64 0.8
65 0.85
66 0.83
67 0.83
68 0.81
69 0.73
70 0.63
71 0.52
72 0.44
73 0.35
74 0.29
75 0.19
76 0.13
77 0.11
78 0.11
79 0.11
80 0.13
81 0.13
82 0.15
83 0.15
84 0.13
85 0.12
86 0.13
87 0.19
88 0.18
89 0.2
90 0.2
91 0.26
92 0.35
93 0.36
94 0.36
95 0.35
96 0.39
97 0.41
98 0.44
99 0.42
100 0.37
101 0.39
102 0.39
103 0.36
104 0.32
105 0.28
106 0.26
107 0.23
108 0.22
109 0.19