Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B1NYW2

Protein Details
Accession A0A0B1NYW2    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MAPANTGAKKQKKKWSKGKVKDKAQHAVIHydrophilic
NLS Segment(s)
PositionSequence
8-23AKKQKKKWSKGKVKDK
Subcellular Location(s) cyto_nucl 9.833, cyto 9.5, nucl 9, mito_nucl 8.333, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPANTGAKKQKKKWSKGKVKDKAQHAVILDKATSDKLYKDVQSYRLVTVATLVDRLKINGSLARKCLKDLEQKGQIKKIVGHSKLQIYTRAVTAAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.87
3 0.89
4 0.9
5 0.93
6 0.92
7 0.92
8 0.89
9 0.85
10 0.82
11 0.72
12 0.65
13 0.55
14 0.48
15 0.39
16 0.32
17 0.25
18 0.18
19 0.16
20 0.13
21 0.13
22 0.1
23 0.09
24 0.11
25 0.14
26 0.15
27 0.18
28 0.2
29 0.23
30 0.27
31 0.27
32 0.25
33 0.23
34 0.22
35 0.18
36 0.16
37 0.13
38 0.08
39 0.09
40 0.08
41 0.09
42 0.09
43 0.1
44 0.09
45 0.09
46 0.1
47 0.12
48 0.16
49 0.17
50 0.2
51 0.24
52 0.24
53 0.24
54 0.27
55 0.29
56 0.36
57 0.39
58 0.45
59 0.5
60 0.56
61 0.59
62 0.6
63 0.58
64 0.5
65 0.48
66 0.49
67 0.49
68 0.45
69 0.46
70 0.45
71 0.49
72 0.52
73 0.5
74 0.46
75 0.39
76 0.39
77 0.35