Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B1P2J3

Protein Details
Accession A0A0B1P2J3    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
107-138EERKIQREQKRLWKLQNRKTKRKGLFNPEAFTHydrophilic
NLS Segment(s)
PositionSequence
112-129QREQKRLWKLQNRKTKRK
150-157RKKKRKGA
Subcellular Location(s) mito 16, nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR000266  Ribosomal_S17/S11  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00366  Ribosomal_S17  
Amino Acid Sequences MSALSLTRKVAGQAKKTIPAVVISAGLMQKTVKARTGVQEWNNHIKKNFNRHKDVLVHDPNDSLRTGDIISISSGMRFSKTVRHIVEDIIAPFDTPIEERPPIPTPEERKIQREQKRLWKLQNRKTKRKGLFNPEAFTLTDQQKEELLNRKKKRKGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.5
3 0.5
4 0.48
5 0.41
6 0.35
7 0.3
8 0.22
9 0.18
10 0.12
11 0.14
12 0.13
13 0.12
14 0.11
15 0.09
16 0.12
17 0.15
18 0.17
19 0.18
20 0.2
21 0.22
22 0.27
23 0.33
24 0.36
25 0.37
26 0.42
27 0.44
28 0.53
29 0.53
30 0.51
31 0.46
32 0.47
33 0.49
34 0.53
35 0.57
36 0.54
37 0.58
38 0.58
39 0.63
40 0.6
41 0.57
42 0.56
43 0.52
44 0.46
45 0.39
46 0.37
47 0.32
48 0.28
49 0.24
50 0.15
51 0.09
52 0.08
53 0.08
54 0.07
55 0.07
56 0.06
57 0.06
58 0.07
59 0.07
60 0.06
61 0.06
62 0.06
63 0.06
64 0.07
65 0.07
66 0.13
67 0.16
68 0.22
69 0.22
70 0.25
71 0.25
72 0.25
73 0.26
74 0.2
75 0.18
76 0.13
77 0.12
78 0.09
79 0.08
80 0.08
81 0.06
82 0.06
83 0.07
84 0.09
85 0.1
86 0.11
87 0.15
88 0.18
89 0.19
90 0.22
91 0.26
92 0.29
93 0.34
94 0.43
95 0.42
96 0.44
97 0.51
98 0.57
99 0.61
100 0.63
101 0.65
102 0.68
103 0.75
104 0.78
105 0.79
106 0.8
107 0.81
108 0.82
109 0.85
110 0.84
111 0.85
112 0.87
113 0.87
114 0.85
115 0.85
116 0.86
117 0.85
118 0.85
119 0.81
120 0.75
121 0.66
122 0.6
123 0.5
124 0.42
125 0.38
126 0.3
127 0.28
128 0.26
129 0.25
130 0.25
131 0.26
132 0.29
133 0.34
134 0.41
135 0.47
136 0.56
137 0.65