Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B2WSM5

Protein Details
Accession A0A0B2WSM5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
95-117GKWPHEARKGWKCKTKQVCCECYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15.5, cyto_mito 12.333, cyto 8, cyto_nucl 4.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR001370  BIR_rpt  
Pfam View protein in Pfam  
PF00653  BIR  
PROSITE View protein in PROSITE  
PS50143  BIR_REPEAT_2  
CDD cd00022  BIR  
Amino Acid Sequences MLPSQTLLTFPSQLARAGFYFEPYPENPDNCVCFLCGKGLDGWEAGDDPLEEHLKHAPQCGWAIVSAIEAEIAEYSRQDPGLPHMVEARKATFAGKWPHEARKGWKCKTKQVCCECYVKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.16
4 0.19
5 0.19
6 0.18
7 0.18
8 0.17
9 0.2
10 0.18
11 0.25
12 0.24
13 0.25
14 0.25
15 0.27
16 0.28
17 0.25
18 0.25
19 0.19
20 0.17
21 0.16
22 0.16
23 0.13
24 0.12
25 0.11
26 0.11
27 0.11
28 0.1
29 0.1
30 0.08
31 0.08
32 0.07
33 0.06
34 0.05
35 0.05
36 0.07
37 0.08
38 0.07
39 0.08
40 0.1
41 0.12
42 0.13
43 0.14
44 0.13
45 0.13
46 0.14
47 0.13
48 0.11
49 0.09
50 0.09
51 0.07
52 0.07
53 0.05
54 0.05
55 0.04
56 0.04
57 0.04
58 0.03
59 0.04
60 0.04
61 0.04
62 0.05
63 0.05
64 0.06
65 0.06
66 0.06
67 0.1
68 0.18
69 0.18
70 0.18
71 0.23
72 0.24
73 0.27
74 0.28
75 0.25
76 0.19
77 0.19
78 0.19
79 0.16
80 0.21
81 0.27
82 0.28
83 0.34
84 0.37
85 0.44
86 0.49
87 0.52
88 0.55
89 0.58
90 0.65
91 0.66
92 0.71
93 0.69
94 0.74
95 0.8
96 0.81
97 0.81
98 0.81
99 0.8
100 0.75